BLASTX nr result
ID: Atractylodes21_contig00012779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00012779 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22090.3| unnamed protein product [Vitis vinifera] 76 3e-12 ref|XP_002279121.1| PREDICTED: hydroxyacylglutathione hydrolase ... 76 3e-12 gb|AFK37965.1| unknown [Lotus japonicus] 75 4e-12 dbj|BAJ34342.1| unnamed protein product [Thellungiella halophila] 75 4e-12 ref|XP_004146003.1| PREDICTED: hydroxyacylglutathione hydrolase ... 74 1e-11 >emb|CBI22090.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +2 Query: 209 KKLLFRQLFEKESSTYTYLLADASHPDKPALLVDPVDK 322 KKLLFRQLFE+ESSTYTYLLAD SHPDKPALL+DPVDK Sbjct: 14 KKLLFRQLFEQESSTYTYLLADVSHPDKPALLIDPVDK 51 >ref|XP_002279121.1| PREDICTED: hydroxyacylglutathione hydrolase 3, mitochondrial-like [Vitis vinifera] Length = 269 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +2 Query: 209 KKLLFRQLFEKESSTYTYLLADASHPDKPALLVDPVDK 322 KKLLFRQLFE+ESSTYTYLLAD SHPDKPALL+DPVDK Sbjct: 25 KKLLFRQLFEQESSTYTYLLADVSHPDKPALLIDPVDK 62 >gb|AFK37965.1| unknown [Lotus japonicus] Length = 288 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 212 KLLFRQLFEKESSTYTYLLADASHPDKPALLVDPVDK 322 KLLFRQLFEKESSTYTYLLADASHP+KPALL+DPVDK Sbjct: 48 KLLFRQLFEKESSTYTYLLADASHPEKPALLIDPVDK 84 >dbj|BAJ34342.1| unnamed protein product [Thellungiella halophila] Length = 286 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +2 Query: 212 KLLFRQLFEKESSTYTYLLADASHPDKPALLVDPVDK 322 KLLFRQLFEKESSTYTYLLAD SHPDKPALL+DPVDK Sbjct: 49 KLLFRQLFEKESSTYTYLLADVSHPDKPALLIDPVDK 85 >ref|XP_004146003.1| PREDICTED: hydroxyacylglutathione hydrolase 3, mitochondrial-like [Cucumis sativus] gi|449503644|ref|XP_004162105.1| PREDICTED: hydroxyacylglutathione hydrolase 3, mitochondrial-like [Cucumis sativus] Length = 295 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 212 KLLFRQLFEKESSTYTYLLADASHPDKPALLVDPVDK 322 KLLFRQLFEK+SSTYTYLLAD SHPDKPALL+DPVDK Sbjct: 55 KLLFRQLFEKDSSTYTYLLADVSHPDKPALLIDPVDK 91