BLASTX nr result
ID: Atractylodes21_contig00012526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00012526 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP97495.1| cellulose synthase [Solanum tuberosum] 77 1e-12 ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic su... 76 3e-12 ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic su... 76 3e-12 gb|AAD39534.2| cellulose synthase catalytic subunit [Gossypium h... 76 3e-12 gb|AEP33559.1| cellulose synthase catalytic subunit [Gossypium t... 76 3e-12 >gb|AAP97495.1| cellulose synthase [Solanum tuberosum] Length = 1083 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTTRVTGPDVQYCGINC 110 VWSILLASIFSLLWVRIDPFTTRVTGPDVQ CGINC Sbjct: 1048 VWSILLASIFSLLWVRIDPFTTRVTGPDVQACGINC 1083 >ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Cucumis sativus] Length = 1070 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTTRVTGPDVQYCGINC 110 VWSILLASIFSLLWVRIDPFTTRVTGPDV+ CGINC Sbjct: 1035 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1070 >ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Cucumis sativus] Length = 1050 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTTRVTGPDVQYCGINC 110 VWSILLASIFSLLWVRIDPFTTRVTGPDV+ CGINC Sbjct: 1015 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1050 >gb|AAD39534.2| cellulose synthase catalytic subunit [Gossypium hirsutum] Length = 1067 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTTRVTGPDVQYCGINC 110 VWSILLASIFSLLWVRIDPFTTRVTGPDV+ CGINC Sbjct: 1032 VWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33559.1| cellulose synthase catalytic subunit [Gossypium trilobum] Length = 1067 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTTRVTGPDVQYCGINC 110 VWSILLASIFSLLWVRIDPFTTRVTGPDV+ CGINC Sbjct: 1032 VWSILLASIFSLLWVRIDPFTTRVTGPDVELCGINC 1067