BLASTX nr result
ID: Atractylodes21_contig00010316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010316 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313317.1| predicted protein [Populus trichocarpa] gi|2... 83 2e-14 ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containi... 79 4e-13 emb|CBI24939.3| unnamed protein product [Vitis vinifera] 79 4e-13 ref|XP_002517779.1| pentatricopeptide repeat-containing protein,... 79 5e-13 ref|XP_004135941.1| PREDICTED: pentatricopeptide repeat-containi... 75 4e-12 >ref|XP_002313317.1| predicted protein [Populus trichocarpa] gi|222849725|gb|EEE87272.1| predicted protein [Populus trichocarpa] Length = 474 Score = 83.2 bits (204), Expect = 2e-14 Identities = 42/70 (60%), Positives = 57/70 (81%) Frame = -3 Query: 211 PSSQGIQRSTQKHMSHILRSEAAIEAIERKANSATVKHNRFSPKLLLEALDNAIRHKRWK 32 P+S G+QR ++K +S ILR+EAAI+AIE+KANS K+N PK +LEALD+AI+ +W+ Sbjct: 39 PTSTGLQRQSKKELSRILRTEAAIKAIEQKANSK--KYNNLWPKAVLEALDDAIKENQWE 96 Query: 31 SALKIFDLLR 2 SALKIF+LLR Sbjct: 97 SALKIFELLR 106 >ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Vitis vinifera] Length = 538 Score = 79.0 bits (193), Expect = 4e-13 Identities = 47/89 (52%), Positives = 59/89 (66%) Frame = -3 Query: 268 PFSKSSSLLITAAKKNSQVPSSQGIQRSTQKHMSHILRSEAAIEAIERKANSATVKHNRF 89 P S L + A K++S S G+QR +K +S ILR+EAAI IERKANS K++ Sbjct: 34 PTSNPPFLFVRAGKRSSG-SSQNGLQRQPKKDLSRILRTEAAISGIERKANSR--KYSTL 90 Query: 88 SPKLLLEALDNAIRHKRWKSALKIFDLLR 2 PK +LEALD AIR R++SALKIF LLR Sbjct: 91 WPKAVLEALDEAIRENRYESALKIFGLLR 119 >emb|CBI24939.3| unnamed protein product [Vitis vinifera] Length = 485 Score = 79.0 bits (193), Expect = 4e-13 Identities = 47/89 (52%), Positives = 59/89 (66%) Frame = -3 Query: 268 PFSKSSSLLITAAKKNSQVPSSQGIQRSTQKHMSHILRSEAAIEAIERKANSATVKHNRF 89 P S L + A K++S S G+QR +K +S ILR+EAAI IERKANS K++ Sbjct: 34 PTSNPPFLFVRAGKRSSG-SSQNGLQRQPKKDLSRILRTEAAISGIERKANSR--KYSTL 90 Query: 88 SPKLLLEALDNAIRHKRWKSALKIFDLLR 2 PK +LEALD AIR R++SALKIF LLR Sbjct: 91 WPKAVLEALDEAIRENRYESALKIFGLLR 119 >ref|XP_002517779.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543051|gb|EEF44586.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 486 Score = 78.6 bits (192), Expect = 5e-13 Identities = 40/66 (60%), Positives = 55/66 (83%) Frame = -3 Query: 199 GIQRSTQKHMSHILRSEAAIEAIERKANSATVKHNRFSPKLLLEALDNAIRHKRWKSALK 20 G +R T+K +S LR++AAI+AIE+KA+S+ K+NR PK +LEALD+AI+ +RWKSALK Sbjct: 56 GPKRHTKKELSRFLRTDAAIKAIEQKADSS--KYNRLWPKAVLEALDDAIKERRWKSALK 113 Query: 19 IFDLLR 2 IF+LLR Sbjct: 114 IFELLR 119 >ref|XP_004135941.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Cucumis sativus] gi|449514880|ref|XP_004164505.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Cucumis sativus] Length = 477 Score = 75.5 bits (184), Expect = 4e-12 Identities = 41/75 (54%), Positives = 52/75 (69%) Frame = -3 Query: 226 KNSQVPSSQGIQRSTQKHMSHILRSEAAIEAIERKANSATVKHNRFSPKLLLEALDNAIR 47 K + SS +QR +K +S ILR +AAI+AIERKANS K+N PK +LEALD AI+ Sbjct: 46 KRTSTQSSDALQRDPKKGLSRILRRDAAIKAIERKANSK--KYNNLWPKAVLEALDEAIQ 103 Query: 46 HKRWKSALKIFDLLR 2 W++ALKIF LLR Sbjct: 104 ENLWETALKIFGLLR 118