BLASTX nr result
ID: Atractylodes21_contig00009464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00009464 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus ... 76 3e-12 ref|XP_002306421.1| predicted protein [Populus trichocarpa] gi|2... 73 2e-11 ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR28... 72 5e-11 ref|NP_201399.1| auxin efflux carrier family protein [Arabidopsi... 70 1e-10 ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp.... 70 1e-10 >ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223539130|gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 406 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/49 (71%), Positives = 45/49 (91%) Frame = -1 Query: 149 MGFWSLFEVASMPILEVLLMSTIGAIMATDYLNLLSSNTRRSINKIVFV 3 MGFW+LFEVASMPI++VLL+S +GA MAT+Y NLL+S+ R+S+NKIVFV Sbjct: 1 MGFWTLFEVASMPIIQVLLISGLGAFMATNYCNLLTSDARKSLNKIVFV 49 >ref|XP_002306421.1| predicted protein [Populus trichocarpa] gi|222855870|gb|EEE93417.1| predicted protein [Populus trichocarpa] Length = 397 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/49 (65%), Positives = 44/49 (89%) Frame = -1 Query: 149 MGFWSLFEVASMPILEVLLMSTIGAIMATDYLNLLSSNTRRSINKIVFV 3 MGFW+LFEVAS+PI++VLL+S GA+MAT+YLNLL + R+S+NK+VF+ Sbjct: 1 MGFWTLFEVASLPIIQVLLISFFGALMATEYLNLLPKDARKSLNKLVFM 49 >ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR287W-like [Vitis vinifera] gi|296082565|emb|CBI21570.3| unnamed protein product [Vitis vinifera] Length = 421 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/49 (63%), Positives = 43/49 (87%) Frame = -1 Query: 149 MGFWSLFEVASMPILEVLLMSTIGAIMATDYLNLLSSNTRRSINKIVFV 3 MGFW+LFEVASMPIL+VL++ ++GA +AT Y N+L ++ R+S+NKIVFV Sbjct: 1 MGFWTLFEVASMPILQVLIIGSVGAFLATGYCNILPADARKSVNKIVFV 49 >ref|NP_201399.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|10177113|dbj|BAB10403.1| unnamed protein product [Arabidopsis thaliana] gi|332010751|gb|AED98134.1| auxin efflux carrier family protein [Arabidopsis thaliana] Length = 395 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/49 (67%), Positives = 43/49 (87%) Frame = -1 Query: 149 MGFWSLFEVASMPILEVLLMSTIGAIMATDYLNLLSSNTRRSINKIVFV 3 MGF L EVASMPI++VLL+S +GA +ATDY +LLS++TRRS+NK+VFV Sbjct: 1 MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFV 49 >ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297312615|gb|EFH43039.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 395 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/49 (67%), Positives = 43/49 (87%) Frame = -1 Query: 149 MGFWSLFEVASMPILEVLLMSTIGAIMATDYLNLLSSNTRRSINKIVFV 3 MGF L EVASMPI++VLL+S +GA +ATDY +LLS++TRRS+NK+VFV Sbjct: 1 MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFV 49