BLASTX nr result
ID: Atractylodes21_contig00009446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00009446 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM34772.1|AF509872_1 nam-like protein 9 [Petunia x hybrida] 78 6e-13 gb|AFP93563.1| NAC [Cestrum nocturnum] 77 1e-12 gb|AAM34767.1|AF509867_1 nam-like protein 4 [Petunia x hybrida] 75 5e-12 gb|AAF09254.1|AF201456_1 NAC2 [Arabidopsis thaliana] 74 2e-11 gb|AAG51388.1|AC011560_20 unknown protein; 75639-73470 [Arabidop... 74 2e-11 >gb|AAM34772.1|AF509872_1 nam-like protein 9 [Petunia x hybrida] Length = 462 Score = 78.2 bits (191), Expect = 6e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 169 PGFRFHPTDEELVRYYLRRKVCGKPFRFDAISDVDVY 279 PGFRFHPTDEELVRYYLRRKVCGKP R DAISD+D+Y Sbjct: 12 PGFRFHPTDEELVRYYLRRKVCGKPLRIDAISDIDIY 48 >gb|AFP93563.1| NAC [Cestrum nocturnum] Length = 414 Score = 77.4 bits (189), Expect = 1e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 169 PGFRFHPTDEELVRYYLRRKVCGKPFRFDAISDVDVY 279 PGFRFHPTDEELVRYYLRRK CGKPFRF A+S++DVY Sbjct: 30 PGFRFHPTDEELVRYYLRRKACGKPFRFQAVSEIDVY 66 >gb|AAM34767.1|AF509867_1 nam-like protein 4 [Petunia x hybrida] Length = 406 Score = 75.1 bits (183), Expect = 5e-12 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 169 PGFRFHPTDEELVRYYLRRKVCGKPFRFDAISDVDVY 279 PGFRFHPTDEELVRYYLRRK C KPFRF A+S++DVY Sbjct: 37 PGFRFHPTDEELVRYYLRRKACAKPFRFQAVSEIDVY 73 >gb|AAF09254.1|AF201456_1 NAC2 [Arabidopsis thaliana] Length = 569 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 169 PGFRFHPTDEELVRYYLRRKVCGKPFRFDAISDVDVY 279 PGFRFHPTDEELVRYYL+RKVC KPF+FDAIS D+Y Sbjct: 11 PGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIY 47 >gb|AAG51388.1|AC011560_20 unknown protein; 75639-73470 [Arabidopsis thaliana] gi|8567779|gb|AAF76351.1| NAC, putative [Arabidopsis thaliana] Length = 558 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 169 PGFRFHPTDEELVRYYLRRKVCGKPFRFDAISDVDVY 279 PGFRFHPTDEELVRYYL+RK+C KPF+FDAIS DVY Sbjct: 11 PGFRFHPTDEELVRYYLKRKICNKPFKFDAISVTDVY 47