BLASTX nr result
ID: Atractylodes21_contig00009283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00009283 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_176447.1| pentatricopeptide repeat-containing protein [Ar... 74 9e-12 gb|AAG52154.1|AC022355_15 unknown protein; 19199-17308 [Arabidop... 74 9e-12 ref|NP_176522.2| pentatricopeptide repeat-containing protein [Ar... 74 9e-12 gb|AAM97065.1| putative membrane-associated salt-inducible prote... 74 9e-12 ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containi... 71 8e-11 >ref|NP_176447.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75213223|sp|Q9SXD8.1|PPR90_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g62590 gi|5454201|gb|AAD43616.1|AC005698_15 T3P18.15 [Arabidopsis thaliana] gi|332195860|gb|AEE33981.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 634 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/66 (51%), Positives = 50/66 (75%) Frame = +3 Query: 6 VTYSTMIQGLFRVGRCGDARKLFDEMHAQGVIPDECTYSIILEGLCNNHQVDEALSVFHL 185 VTY+T+IQGLF G C +A+K+F +M + GV PD TYSI+L+GLCNN ++++AL VF Sbjct: 436 VTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNNGKLEKALEVFDY 495 Query: 186 VHDSKL 203 + S++ Sbjct: 496 MQKSEI 501 >gb|AAG52154.1|AC022355_15 unknown protein; 19199-17308 [Arabidopsis thaliana] Length = 558 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/66 (51%), Positives = 50/66 (75%) Frame = +3 Query: 6 VTYSTMIQGLFRVGRCGDARKLFDEMHAQGVIPDECTYSIILEGLCNNHQVDEALSVFHL 185 VTY+T+IQGLF G C +A+K+F +M + GV PD TYSI+L+GLCNN ++++AL VF Sbjct: 360 VTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNNGKLEKALEVFDY 419 Query: 186 VHDSKL 203 + S++ Sbjct: 420 MQKSEI 425 >ref|NP_176522.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806282|sp|Q9C8T7.2|PP101_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g63330 gi|332195966|gb|AEE34087.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 559 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/66 (51%), Positives = 50/66 (75%) Frame = +3 Query: 6 VTYSTMIQGLFRVGRCGDARKLFDEMHAQGVIPDECTYSIILEGLCNNHQVDEALSVFHL 185 VTY+T+IQGLF G C +A+K+F +M + GV PD TYSI+L+GLCNN ++++AL VF Sbjct: 361 VTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNNGKLEKALEVFDY 420 Query: 186 VHDSKL 203 + S++ Sbjct: 421 MQKSEI 426 >gb|AAM97065.1| putative membrane-associated salt-inducible protein [Arabidopsis thaliana] gi|62320656|dbj|BAD95323.1| putative membrane-associated salt-inducible protein [Arabidopsis thaliana] Length = 596 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/66 (51%), Positives = 50/66 (75%) Frame = +3 Query: 6 VTYSTMIQGLFRVGRCGDARKLFDEMHAQGVIPDECTYSIILEGLCNNHQVDEALSVFHL 185 VTY+T+IQGLF G C +A+K+F +M + GV PD TYSI+L+GLCNN ++++AL VF Sbjct: 398 VTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNNGKLEKALEVFDY 457 Query: 186 VHDSKL 203 + S++ Sbjct: 458 MQKSEI 463 >ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 71.2 bits (173), Expect = 8e-11 Identities = 29/64 (45%), Positives = 45/64 (70%) Frame = +3 Query: 3 VVTYSTMIQGLFRVGRCGDARKLFDEMHAQGVIPDECTYSIILEGLCNNHQVDEALSVFH 182 V+TY+T++ GLFR G+ DA LF EM + P+ CTY+I+L+GLC N+ + EA+ +FH Sbjct: 413 VITYNTLLTGLFREGKVRDAWNLFGEMKVHDLTPESCTYNILLDGLCKNNHLSEAMELFH 472 Query: 183 LVHD 194 + + Sbjct: 473 YLEN 476