BLASTX nr result
ID: Atractylodes21_contig00009070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00009070 (562 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW69805.1| Hop-interacting protein THI044 [Solanum lycopersi... 57 3e-06 ref|XP_002262674.1| PREDICTED: protein ACCUMULATION AND REPLICAT... 55 8e-06 ref|XP_002307697.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 emb|CAN78894.1| hypothetical protein VITISV_009566 [Vitis vinifera] 55 8e-06 >gb|AEW69805.1| Hop-interacting protein THI044 [Solanum lycopersicum] Length = 819 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 560 LCSLLIGEVDKCCSWLGLNNENSPYKGPSIATF 462 LCSLL+GEVD C SWLGL++E+SPY+ PSI TF Sbjct: 431 LCSLLVGEVDGCRSWLGLDSEDSPYRDPSIVTF 463 >ref|XP_002262674.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic [Vitis vinifera] gi|296088380|emb|CBI37371.3| unnamed protein product [Vitis vinifera] Length = 800 Score = 55.1 bits (131), Expect = 8e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 560 LCSLLIGEVDKCCSWLGLNNENSPYKGPSIATF 462 LCSLL+GE+D+C SWLGL+N +SPY+ PSI F Sbjct: 419 LCSLLVGEIDECRSWLGLDNHSSPYRDPSIVEF 451 >ref|XP_002307697.1| predicted protein [Populus trichocarpa] gi|222857146|gb|EEE94693.1| predicted protein [Populus trichocarpa] Length = 768 Score = 55.1 bits (131), Expect = 8e-06 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -3 Query: 560 LCSLLIGEVDKCCSWLGLNNENSPYKGPSIATF 462 LCSLL+GE+D+CC W+GL+++NSPY+ P I F Sbjct: 409 LCSLLVGELDECCKWMGLDSDNSPYRNPPIFDF 441 >emb|CAN78894.1| hypothetical protein VITISV_009566 [Vitis vinifera] Length = 789 Score = 55.1 bits (131), Expect = 8e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 560 LCSLLIGEVDKCCSWLGLNNENSPYKGPSIATF 462 LCSLL+GE+D+C SWLGL+N +SPY+ PSI F Sbjct: 408 LCSLLVGEIDECRSWLGLDNHSSPYRDPSIVEF 440