BLASTX nr result
ID: Atractylodes21_contig00009043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00009043 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634692.1| PREDICTED: flavoprotein wrbA isoform 2 [Viti... 101 6e-20 ref|XP_002283286.1| PREDICTED: flavoprotein wrbA isoform 1 [Viti... 101 6e-20 gb|AAO12869.1| putative quinone reductase, partial [Vitis vinifera] 101 6e-20 ref|XP_002534445.1| Minor allergen Alt a, putative [Ricinus comm... 100 1e-19 ref|XP_002316953.1| predicted protein [Populus trichocarpa] gi|2... 100 1e-19 >ref|XP_003634692.1| PREDICTED: flavoprotein wrbA isoform 2 [Vitis vinifera] Length = 192 Score = 101 bits (252), Expect = 6e-20 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 328 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTLAGDGSRQPSELELEQAF 182 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGT AGDGSRQPSELELEQAF Sbjct: 127 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPSELELEQAF 175 >ref|XP_002283286.1| PREDICTED: flavoprotein wrbA isoform 1 [Vitis vinifera] gi|147788048|emb|CAN78237.1| hypothetical protein VITISV_016391 [Vitis vinifera] gi|302143167|emb|CBI20462.3| unnamed protein product [Vitis vinifera] Length = 203 Score = 101 bits (252), Expect = 6e-20 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 328 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTLAGDGSRQPSELELEQAF 182 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGT AGDGSRQPSELELEQAF Sbjct: 138 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPSELELEQAF 186 >gb|AAO12869.1| putative quinone reductase, partial [Vitis vinifera] Length = 166 Score = 101 bits (252), Expect = 6e-20 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 328 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTLAGDGSRQPSELELEQAF 182 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGT AGDGSRQPSELELEQAF Sbjct: 101 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPSELELEQAF 149 >ref|XP_002534445.1| Minor allergen Alt a, putative [Ricinus communis] gi|223525276|gb|EEF27937.1| Minor allergen Alt a, putative [Ricinus communis] Length = 203 Score = 100 bits (249), Expect = 1e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 328 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTLAGDGSRQPSELELEQAF 182 GM+FVPIGYTFGAGMFEMEKVKGGSPYGAGT AGDGSRQPSELELEQAF Sbjct: 138 GMLFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELEQAF 186 >ref|XP_002316953.1| predicted protein [Populus trichocarpa] gi|222860018|gb|EEE97565.1| predicted protein [Populus trichocarpa] Length = 203 Score = 100 bits (249), Expect = 1e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 328 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTLAGDGSRQPSELELEQAF 182 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGT AGDGSRQP+ELELEQAF Sbjct: 138 GMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAF 186