BLASTX nr result
ID: Atractylodes21_contig00008709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00008709 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF81465.1| TIR-NBS-LRR type disease resistance protein [Popu... 55 8e-06 >gb|ABF81465.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa] Length = 1139 Score = 54.7 bits (130), Expect = 8e-06 Identities = 35/75 (46%), Positives = 45/75 (60%) Frame = -3 Query: 226 GTAIKHLPDSIGLLKNLTILSVHKNHRSLVTKSHFPFFQFLALPPSLNATSFLPPSISGL 47 GTAI+ LP SIG LKNL+ LS+ L + S F L P ++ L P+ +GL Sbjct: 814 GTAIERLPSSIGHLKNLSNLSLGGFKYDLSSVSWFSHI-LPWLSPRISNPRALLPTFTGL 872 Query: 46 HSLSELNLSYCGLSD 2 +SL L+LSYCGLSD Sbjct: 873 NSLRRLDLSYCGLSD 887