BLASTX nr result
ID: Atractylodes21_contig00008705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00008705 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310754.1| predicted protein [Populus trichocarpa] gi|2... 83 2e-22 ref|XP_002310756.1| predicted protein [Populus trichocarpa] gi|2... 83 5e-22 ref|XP_002270043.1| PREDICTED: polyneuridine-aldehyde esterase [... 84 6e-21 ref|NP_001240864.1| uncharacterized protein LOC100796281 [Glycin... 77 5e-20 gb|ACU23966.1| unknown [Glycine max] 77 5e-20 >ref|XP_002310754.1| predicted protein [Populus trichocarpa] gi|222853657|gb|EEE91204.1| predicted protein [Populus trichocarpa] Length = 263 Score = 83.2 bits (204), Expect(2) = 2e-22 Identities = 38/56 (67%), Positives = 48/56 (85%) Frame = +3 Query: 321 NTKVIQQVTTLSDYTKPLLEFMAAIPPAEKVVLVGHSLGGMNLALAMEMFPEKVSV 488 N K IQ V TL +YT+PLLEF+A++ P EKV+LVGHSLGG++LALAME FPEK++V Sbjct: 48 NMKAIQDVETLDEYTEPLLEFLASLQPKEKVILVGHSLGGLSLALAMEKFPEKIAV 103 Score = 47.8 bits (112), Expect(2) = 2e-22 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 176 QKHFVLVHGACHGAWCW 226 QKHFVLVHGACHGAWCW Sbjct: 7 QKHFVLVHGACHGAWCW 23 >ref|XP_002310756.1| predicted protein [Populus trichocarpa] gi|222853659|gb|EEE91206.1| predicted protein [Populus trichocarpa] Length = 263 Score = 83.2 bits (204), Expect(2) = 5e-22 Identities = 38/56 (67%), Positives = 48/56 (85%) Frame = +3 Query: 321 NTKVIQQVTTLSDYTKPLLEFMAAIPPAEKVVLVGHSLGGMNLALAMEMFPEKVSV 488 N K IQ V TL +YT+PLLEF+A++ P EKV+LVGHSLGG++LALAME FPEK++V Sbjct: 48 NMKAIQDVETLDEYTEPLLEFLASLQPKEKVILVGHSLGGLSLALAMEKFPEKIAV 103 Score = 46.2 bits (108), Expect(2) = 5e-22 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 176 QKHFVLVHGACHGAWCW 226 Q+HFVLVHGACHGAWCW Sbjct: 7 QEHFVLVHGACHGAWCW 23 >ref|XP_002270043.1| PREDICTED: polyneuridine-aldehyde esterase [Vitis vinifera] gi|297735849|emb|CBI18569.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 83.6 bits (205), Expect(2) = 6e-21 Identities = 39/56 (69%), Positives = 49/56 (87%) Frame = +3 Query: 321 NTKVIQQVTTLSDYTKPLLEFMAAIPPAEKVVLVGHSLGGMNLALAMEMFPEKVSV 488 N K IQ+V ++ +Y++PLLE MAA+PP EKV+LVGHSLGG+NLA+AME FPEKVSV Sbjct: 49 NRKQIQEVHSMHEYSQPLLEMMAALPPNEKVILVGHSLGGLNLAVAMEKFPEKVSV 104 Score = 42.0 bits (97), Expect(2) = 6e-21 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 173 QQKHFVLVHGACHGAWCW 226 Q +HFVLVHGACHGAW W Sbjct: 7 QGRHFVLVHGACHGAWTW 24 >ref|NP_001240864.1| uncharacterized protein LOC100796281 [Glycine max] gi|255645162|gb|ACU23079.1| unknown [Glycine max] Length = 261 Score = 77.4 bits (189), Expect(2) = 5e-20 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = +3 Query: 321 NTKVIQQVTTLSDYTKPLLEFMAAIPPAEKVVLVGHSLGGMNLALAMEMFPEKVSV 488 N K I+ V T S+Y+ PLL+ MA IP EK+VLVGHSLGG+N+ALAME FPEKV+V Sbjct: 50 NMKKIEDVDTFSEYSAPLLQLMATIPSNEKLVLVGHSLGGLNIALAMEKFPEKVAV 105 Score = 45.1 bits (105), Expect(2) = 5e-20 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +2 Query: 176 QKHFVLVHGACHGAWCW 226 +KH+VLVHGACHGAWCW Sbjct: 9 RKHYVLVHGACHGAWCW 25 >gb|ACU23966.1| unknown [Glycine max] Length = 249 Score = 77.4 bits (189), Expect(2) = 5e-20 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = +3 Query: 321 NTKVIQQVTTLSDYTKPLLEFMAAIPPAEKVVLVGHSLGGMNLALAMEMFPEKVSV 488 N K I+ V T S+Y+ PLL+ MA IP EK+VLVGHSLGG+N+ALAME FPEKV+V Sbjct: 50 NMKKIEDVDTFSEYSAPLLQLMATIPSNEKLVLVGHSLGGLNIALAMEKFPEKVAV 105 Score = 45.1 bits (105), Expect(2) = 5e-20 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +2 Query: 176 QKHFVLVHGACHGAWCW 226 +KH+VLVHGACHGAWCW Sbjct: 9 RKHYVLVHGACHGAWCW 25