BLASTX nr result
ID: Atractylodes21_contig00008355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00008355 (527 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA35941.1| TPA: hypothetical protein ZEAMMB73_494533 [Zea m... 124 5e-30 gb|AFW61048.1| autophagy 8e, mRNA, partial [Zea mays] 124 5e-30 ref|NP_001137493.1| LOC100240695 [Zea mays] gi|221137343|ref|NP_... 124 5e-30 ref|NP_001137496.1| autophagy-related 8e [Zea mays] gi|195604696... 124 5e-30 gb|AAY67885.1| microtubule associated protein 1A/1B light chain ... 124 5e-30 >tpg|DAA35941.1| TPA: hypothetical protein ZEAMMB73_494533 [Zea mays] Length = 112 Score = 124 bits (312), Expect(2) = 5e-30 Identities = 63/64 (98%), Positives = 63/64 (98%) Frame = -1 Query: 527 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV 348 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV Sbjct: 15 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV 74 Query: 347 KNIL 336 KN L Sbjct: 75 KNTL 78 Score = 31.6 bits (70), Expect(2) = 5e-30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 226 YMTYSGENTFGLL 188 YMTYSGENTFGLL Sbjct: 100 YMTYSGENTFGLL 112 >gb|AFW61048.1| autophagy 8e, mRNA, partial [Zea mays] Length = 107 Score = 124 bits (312), Expect(2) = 5e-30 Identities = 63/64 (98%), Positives = 63/64 (98%) Frame = -1 Query: 527 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV 348 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV Sbjct: 10 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV 69 Query: 347 KNIL 336 KN L Sbjct: 70 KNTL 73 Score = 31.6 bits (70), Expect(2) = 5e-30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 226 YMTYSGENTFGLL 188 YMTYSGENTFGLL Sbjct: 95 YMTYSGENTFGLL 107 >ref|NP_001137493.1| LOC100240695 [Zea mays] gi|221137343|ref|NP_001137494.1| autophagy-related 8c [Zea mays] gi|195613426|gb|ACG28543.1| autophagy-related protein 8 precursor [Zea mays] gi|195620914|gb|ACG32287.1| autophagy-related protein 8 precursor [Zea mays] gi|195622930|gb|ACG33295.1| autophagy-related protein 8 precursor [Zea mays] gi|195624348|gb|ACG34004.1| autophagy-related protein 8 precursor [Zea mays] gi|216963290|gb|ACJ73921.1| autophagy-related 8b variant 1 [Zea mays] gi|216963293|gb|ACJ73922.1| autophagy-related 8c variant 1 [Zea mays] gi|223942753|gb|ACN25460.1| unknown [Zea mays] gi|223975393|gb|ACN31884.1| unknown [Zea mays] gi|413919569|gb|AFW59501.1| autophagy 8b variant 1Autophagy- 8c variant 1Autophagy-related protein 8 isoform 1 [Zea mays] gi|413919570|gb|AFW59502.1| autophagy 8b variant 1Autophagy- 8c variant 1Autophagy-related protein 8 isoform 2 [Zea mays] gi|413919571|gb|AFW59503.1| autophagy 8b variant 1Autophagy- 8c variant 1Autophagy-related protein 8 isoform 3 [Zea mays] gi|413919572|gb|AFW59504.1| autophagy 8b variant 1Autophagy- 8c variant 1Autophagy-related protein 8 isoform 4 [Zea mays] gi|413919573|gb|AFW59505.1| autophagy 8b variant 1Autophagy- 8c variant 1Autophagy-related protein 8 isoform 5 [Zea mays] gi|414585367|tpg|DAA35938.1| TPA: autophagy 8b variant 1Autophagy- 8c variant 1Autophagy-related protein 8 isoform 1 [Zea mays] gi|414585368|tpg|DAA35939.1| TPA: autophagy 8b variant 1Autophagy- 8c variant 1Autophagy-related protein 8 isoform 2 [Zea mays] gi|414585369|tpg|DAA35940.1| TPA: autophagy 8b variant 1Autophagy- 8c variant 1Autophagy-related protein 8 isoform 3 [Zea mays] Length = 120 Score = 124 bits (312), Expect(2) = 5e-30 Identities = 63/64 (98%), Positives = 63/64 (98%) Frame = -1 Query: 527 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV 348 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV Sbjct: 23 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV 82 Query: 347 KNIL 336 KN L Sbjct: 83 KNTL 86 Score = 31.6 bits (70), Expect(2) = 5e-30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 226 YMTYSGENTFGLL 188 YMTYSGENTFGLL Sbjct: 108 YMTYSGENTFGLL 120 >ref|NP_001137496.1| autophagy-related 8e [Zea mays] gi|195604696|gb|ACG24178.1| autophagy-related protein 8 precursor [Zea mays] gi|195636936|gb|ACG37936.1| autophagy-related protein 8 precursor [Zea mays] gi|195647122|gb|ACG43029.1| autophagy-related protein 8 precursor [Zea mays] gi|216963301|gb|ACJ73925.1| autophagy-related 8e variant 1 [Zea mays] gi|223974049|gb|ACN31212.1| unknown [Zea mays] Length = 119 Score = 124 bits (312), Expect(2) = 5e-30 Identities = 63/64 (98%), Positives = 63/64 (98%) Frame = -1 Query: 527 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV 348 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV Sbjct: 22 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV 81 Query: 347 KNIL 336 KN L Sbjct: 82 KNTL 85 Score = 31.6 bits (70), Expect(2) = 5e-30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 226 YMTYSGENTFGLL 188 YMTYSGENTFGLL Sbjct: 107 YMTYSGENTFGLL 119 >gb|AAY67885.1| microtubule associated protein 1A/1B light chain 3 [Saccharum hybrid cultivar B4362] Length = 101 Score = 124 bits (312), Expect(2) = 5e-30 Identities = 63/64 (98%), Positives = 63/64 (98%) Frame = -1 Query: 527 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV 348 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV Sbjct: 4 IREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFV 63 Query: 347 KNIL 336 KN L Sbjct: 64 KNTL 67 Score = 31.6 bits (70), Expect(2) = 5e-30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 226 YMTYSGENTFGLL 188 YMTYSGENTFGLL Sbjct: 89 YMTYSGENTFGLL 101