BLASTX nr result
ID: Atractylodes21_contig00008047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00008047 (561 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517792.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 ref|NP_191304.1| uncharacterized protein [Arabidopsis thaliana] ... 74 2e-11 ref|XP_002876422.1| hypothetical protein ARALYDRAFT_486190 [Arab... 73 4e-11 ref|XP_002532075.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|XP_002336094.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 >ref|XP_002517792.1| conserved hypothetical protein [Ricinus communis] gi|223543064|gb|EEF44599.1| conserved hypothetical protein [Ricinus communis] Length = 79 Score = 74.3 bits (181), Expect = 1e-11 Identities = 37/58 (63%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = -1 Query: 423 MGKYTELLDA-FRIVCRFHSHCPQTARMYYHPPA--DNHSHDGDGKAIDARADGRDGV 259 MGKY E+LDA RIV RFHSHCPQTARMYYHPPA D H H DG + +DG + V Sbjct: 1 MGKYMEILDAGVRIVARFHSHCPQTARMYYHPPANSDEHHHHHDGGSTATASDGSNRV 58 >ref|NP_191304.1| uncharacterized protein [Arabidopsis thaliana] gi|6706416|emb|CAB66102.1| putative protein [Arabidopsis thaliana] gi|21537251|gb|AAM61592.1| unknown [Arabidopsis thaliana] gi|98961017|gb|ABF58992.1| At3g57450 [Arabidopsis thaliana] gi|332646135|gb|AEE79656.1| uncharacterized protein [Arabidopsis thaliana] Length = 96 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/44 (72%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -1 Query: 423 MGKYTELLDA-FRIVCRFHSHCPQTARMYYHPPADNHSHDGDGK 295 MGKYTE+LD RI RFHSHCPQTAR+YYHPP+DNH H G K Sbjct: 1 MGKYTEMLDVGVRIAARFHSHCPQTARLYYHPPSDNHHHHGGVK 44 >ref|XP_002876422.1| hypothetical protein ARALYDRAFT_486190 [Arabidopsis lyrata subsp. lyrata] gi|297322260|gb|EFH52681.1| hypothetical protein ARALYDRAFT_486190 [Arabidopsis lyrata subsp. lyrata] Length = 88 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/44 (72%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -1 Query: 423 MGKYTELLDA-FRIVCRFHSHCPQTARMYYHPPADNHSHDGDGK 295 MGKYTE+LDA RI RFHSHCPQTAR+YYHPP+D H H G K Sbjct: 1 MGKYTEMLDAGVRIAARFHSHCPQTARLYYHPPSDGHHHHGGVK 44 >ref|XP_002532075.1| conserved hypothetical protein [Ricinus communis] gi|223528257|gb|EEF30309.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 4/43 (9%) Frame = -1 Query: 423 MGKYTELLDAFRIVCRFHSHCPQTARMYYHPPA----DNHSHD 307 MGKY ELLDA RI RF+SHCPQTARMYYHPPA D+H HD Sbjct: 1 MGKYVELLDALRIAGRFYSHCPQTARMYYHPPAASSDDHHQHD 43 >ref|XP_002336094.1| predicted protein [Populus trichocarpa] gi|222872213|gb|EEF09344.1| predicted protein [Populus trichocarpa] Length = 73 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -1 Query: 423 MGKYTELLDA-FRIVCRFHSHCPQTARMYYHPPADNHSH 310 MGKYTE+LDA RI RFHSHCPQTARMYYHPP + SH Sbjct: 1 MGKYTEILDAGIRIASRFHSHCPQTARMYYHPPTNADSH 39