BLASTX nr result
ID: Atractylodes21_contig00007834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00007834 (587 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-contai... 250 1e-64 ref|XP_003519389.1| PREDICTED: pleckstrin homology domain-contai... 248 7e-64 ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycin... 245 3e-63 ref|XP_003616621.1| Pleckstrin homology domain-containing protei... 239 2e-61 ref|XP_002314112.1| predicted protein [Populus trichocarpa] gi|2... 238 4e-61 >ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] Length = 143 Score = 250 bits (639), Expect = 1e-64 Identities = 117/128 (91%), Positives = 123/128 (96%) Frame = +1 Query: 10 DDYDGVEYWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKEAIVTRGSHPRGVIPV 189 DDY GVE+WSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKE+ +TR S PRGVIPV Sbjct: 16 DDYGGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKESTITRASRPRGVIPV 75 Query: 190 ATCLTVKGAEDVLNKQFAFELSTRSETMYFIADSEKEKEDWINSIGRSIVQHSRSVTDNE 369 A+CLTVKGAEDVLNKQFAFELSTR+ETMYFIADSEKEKEDWINSIGRSIVQHSRSVTD+E Sbjct: 76 ASCLTVKGAEDVLNKQFAFELSTRTETMYFIADSEKEKEDWINSIGRSIVQHSRSVTDSE 135 Query: 370 IVDYDSNR 393 IVDYDS R Sbjct: 136 IVDYDSKR 143 >ref|XP_003519389.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Glycine max] Length = 148 Score = 248 bits (632), Expect = 7e-64 Identities = 116/129 (89%), Positives = 122/129 (94%) Frame = +1 Query: 4 NPDDYDGVEYWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKEAIVTRGSHPRGVI 183 N DYDGVE+WSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKE+ VTR S PRGV+ Sbjct: 14 NATDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKESSVTRASRPRGVV 73 Query: 184 PVATCLTVKGAEDVLNKQFAFELSTRSETMYFIADSEKEKEDWINSIGRSIVQHSRSVTD 363 PVATCLTVKGAED+LNK AFELSTRS+TMYFIADSEKEKEDWINSIGRSIVQHSRSVTD Sbjct: 74 PVATCLTVKGAEDILNKPNAFELSTRSDTMYFIADSEKEKEDWINSIGRSIVQHSRSVTD 133 Query: 364 NEIVDYDSN 390 +EIVDYDSN Sbjct: 134 SEIVDYDSN 142 >ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycine max] gi|255633474|gb|ACU17095.1| unknown [Glycine max] Length = 146 Score = 245 bits (626), Expect = 3e-63 Identities = 113/129 (87%), Positives = 122/129 (94%) Frame = +1 Query: 4 NPDDYDGVEYWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKEAIVTRGSHPRGVI 183 N DYDGVE+WSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFK++ VTR S PRGV+ Sbjct: 14 NATDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKDSAVTRASRPRGVV 73 Query: 184 PVATCLTVKGAEDVLNKQFAFELSTRSETMYFIADSEKEKEDWINSIGRSIVQHSRSVTD 363 PVATCLTVKGAED+LNK AFELSTRS+TMYFIADSEKEKEDWINSIGRSIVQHSRSVTD Sbjct: 74 PVATCLTVKGAEDILNKPNAFELSTRSDTMYFIADSEKEKEDWINSIGRSIVQHSRSVTD 133 Query: 364 NEIVDYDSN 390 +EI+DYD+N Sbjct: 134 SEIIDYDNN 142 >ref|XP_003616621.1| Pleckstrin homology domain-containing protein [Medicago truncatula] gi|355517956|gb|AES99579.1| Pleckstrin homology domain-containing protein [Medicago truncatula] gi|388509562|gb|AFK42847.1| unknown [Medicago truncatula] Length = 144 Score = 239 bits (610), Expect = 2e-61 Identities = 109/130 (83%), Positives = 122/130 (93%) Frame = +1 Query: 4 NPDDYDGVEYWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKEAIVTRGSHPRGVI 183 NP DY GVE+WSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKE+ +TR S PRGVI Sbjct: 15 NPVDYSGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKESTITRASIPRGVI 74 Query: 184 PVATCLTVKGAEDVLNKQFAFELSTRSETMYFIADSEKEKEDWINSIGRSIVQHSRSVTD 363 PVATCLTVKGAED+L+K +AFELSTR++TMYFIADS+KEKEDWINSIGRSIV HSRSVTD Sbjct: 75 PVATCLTVKGAEDILHKPYAFELSTRADTMYFIADSDKEKEDWINSIGRSIVLHSRSVTD 134 Query: 364 NEIVDYDSNR 393 +EI+DYD+ + Sbjct: 135 SEIIDYDNGK 144 >ref|XP_002314112.1| predicted protein [Populus trichocarpa] gi|222850520|gb|EEE88067.1| predicted protein [Populus trichocarpa] Length = 143 Score = 238 bits (608), Expect = 4e-61 Identities = 111/131 (84%), Positives = 119/131 (90%) Frame = +1 Query: 1 PNPDDYDGVEYWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKEAIVTRGSHPRGV 180 PNPDDY +E+WS+PER+GWLTKQG+YIKTWRRRWFVLKQGKL WFKE VTRGS PRGV Sbjct: 13 PNPDDYRNIEFWSDPERSGWLTKQGDYIKTWRRRWFVLKQGKLLWFKERSVTRGSIPRGV 72 Query: 181 IPVATCLTVKGAEDVLNKQFAFELSTRSETMYFIADSEKEKEDWINSIGRSIVQHSRSVT 360 IPV CLTVKGAEDVLNK +AFELST ETMYFIADSEKEKE+WINSIGRSIVQHSRSVT Sbjct: 73 IPVGKCLTVKGAEDVLNKPYAFELSTSQETMYFIADSEKEKEEWINSIGRSIVQHSRSVT 132 Query: 361 DNEIVDYDSNR 393 D+EIVDYDS R Sbjct: 133 DSEIVDYDSTR 143