BLASTX nr result
ID: Atractylodes21_contig00004806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00004806 (3249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534311.1| succinate dehydrogenase, putative [Ricinus c... 92 1e-15 ref|XP_002264752.2| PREDICTED: succinate dehydrogenase [ubiquino... 90 3e-15 emb|CBI40993.3| unnamed protein product [Vitis vinifera] 90 3e-15 ref|NP_680465.2| succinate dehydrogenase [ubiquinone] iron-sulfu... 87 3e-14 ref|XP_004146922.1| PREDICTED: succinate dehydrogenase [ubiquino... 87 4e-14 >ref|XP_002534311.1| succinate dehydrogenase, putative [Ricinus communis] gi|223525519|gb|EEF28073.1| succinate dehydrogenase, putative [Ricinus communis] Length = 313 Score = 91.7 bits (226), Expect = 1e-15 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -3 Query: 172 LLDALQEIKSEDDSSLSYKRSCRAGICGSCAMNIDGTNTVACLKPIDTYT 23 +LDALQ+IK+EDDSSLSY+RSCR GICGSC+MNIDGTNTVACLKPID T Sbjct: 97 VLDALQKIKAEDDSSLSYRRSCREGICGSCSMNIDGTNTVACLKPIDADT 146 >ref|XP_002264752.2| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial-like [Vitis vinifera] Length = 303 Score = 90.1 bits (222), Expect = 3e-15 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = -3 Query: 172 LLDALQEIKSEDDSSLSYKRSCRAGICGSCAMNIDGTNTVACLKPIDTYT 23 +LDALQ+IK+E+DSSLSY+RSCR GICGSCAMNIDGTNTVACL+PID T Sbjct: 91 VLDALQKIKAEEDSSLSYRRSCREGICGSCAMNIDGTNTVACLRPIDADT 140 >emb|CBI40993.3| unnamed protein product [Vitis vinifera] Length = 158 Score = 90.1 bits (222), Expect = 3e-15 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = -3 Query: 172 LLDALQEIKSEDDSSLSYKRSCRAGICGSCAMNIDGTNTVACLKPIDTYT 23 +LDALQ+IK+E+DSSLSY+RSCR GICGSCAMNIDGTNTVACL+PID T Sbjct: 91 VLDALQKIKAEEDSSLSYRRSCREGICGSCAMNIDGTNTVACLRPIDADT 140 >ref|NP_680465.2| succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3 [Arabidopsis thaliana] gi|75262571|sp|Q9FJP9.1|DHSB3_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial; AltName: Full=Iron-sulfur subunit of complex II; Short=Ip; Flags: Precursor gi|10178178|dbj|BAB11652.1| succinate dehydrogenase iron-sulfur protein-like [Arabidopsis thaliana] gi|12049602|emb|CAC19857.1| mitochondrial succinate dehydrogenase iron-sulphur subunit [Arabidopsis thaliana] gi|332010628|gb|AED98011.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3 [Arabidopsis thaliana] Length = 309 Score = 87.0 bits (214), Expect = 3e-14 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = -3 Query: 172 LLDALQEIKSEDDSSLSYKRSCRAGICGSCAMNIDGTNTVACLKPIDTYT 23 +LD LQ+IK+EDD+SLSY+RSCR GICGSC+MNIDGTNTVACLKPI+ T Sbjct: 99 VLDVLQKIKAEDDASLSYRRSCREGICGSCSMNIDGTNTVACLKPINPNT 148 >ref|XP_004146922.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial-like [Cucumis sativus] gi|449522744|ref|XP_004168386.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial-like [Cucumis sativus] Length = 293 Score = 86.7 bits (213), Expect = 4e-14 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -3 Query: 172 LLDALQEIKSEDDSSLSYKRSCRAGICGSCAMNIDGTNTVACLKPIDTYT 23 +LDALQ+IK+E DSSLSY+RSCR GICGSC MNIDG NTVACLKPID T Sbjct: 84 VLDALQKIKAEKDSSLSYRRSCREGICGSCGMNIDGANTVACLKPIDADT 133