BLASTX nr result
ID: Atractylodes21_contig00003570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00003570 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32849.3| unnamed protein product [Vitis vinifera] 92 3e-17 ref|XP_002283683.1| PREDICTED: somatic embryogenesis receptor ki... 92 3e-17 gb|AAR83872.1| induced stolon tip protein LRP [Capsicum annuum] 92 3e-17 gb|AAP23944.1| leucine-rich repeat protein [x Citrofortunella mi... 92 4e-17 gb|ACN94266.1| leucine-rich repeat protein [Solenostemon scutell... 90 2e-16 >emb|CBI32849.3| unnamed protein product [Vitis vinifera] Length = 302 Score = 92.4 bits (228), Expect = 3e-17 Identities = 43/56 (76%), Positives = 44/56 (78%) Frame = -3 Query: 169 LVLLIVLAAHFTSTVSGNSEGDALYALRRSLYDPDKVLQSWDPNLVNPCTWFHITC 2 LV L VL+ V GNSEGDALY LRRSL DPD VLQSWDPNLVNPCTWFHITC Sbjct: 95 LVALTVLSVMRVGLVRGNSEGDALYTLRRSLSDPDNVLQSWDPNLVNPCTWFHITC 150 >ref|XP_002283683.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Vitis vinifera] Length = 218 Score = 92.4 bits (228), Expect = 3e-17 Identities = 43/56 (76%), Positives = 44/56 (78%) Frame = -3 Query: 169 LVLLIVLAAHFTSTVSGNSEGDALYALRRSLYDPDKVLQSWDPNLVNPCTWFHITC 2 LV L VL+ V GNSEGDALY LRRSL DPD VLQSWDPNLVNPCTWFHITC Sbjct: 11 LVALTVLSVMRVGLVRGNSEGDALYTLRRSLSDPDNVLQSWDPNLVNPCTWFHITC 66 >gb|AAR83872.1| induced stolon tip protein LRP [Capsicum annuum] Length = 101 Score = 92.4 bits (228), Expect = 3e-17 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -3 Query: 172 FLVLLIVLAAHFTSTVSGNSEGDALYALRRSLYDPDKVLQSWDPNLVNPCTWFHITC 2 FL +++VLA +V GNSEGDALYALRRSL DPD VLQSWDPNLVNPCTWFH+TC Sbjct: 17 FLGVVLVLAV----SVKGNSEGDALYALRRSLSDPDNVLQSWDPNLVNPCTWFHVTC 69 >gb|AAP23944.1| leucine-rich repeat protein [x Citrofortunella microcarpa] Length = 228 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = -3 Query: 175 SFLVLLIVLAAHFTSTVSGNSEGDALYALRRSLYDPDKVLQSWDPNLVNPCTWFHITC 2 S +++I+ ++ + VSGNSEGDALYALRRSL DPD VLQSWDP LVNPCTWFHITC Sbjct: 19 SVSLIIIIGSSSLVAVVSGNSEGDALYALRRSLSDPDYVLQSWDPTLVNPCTWFHITC 76 >gb|ACN94266.1| leucine-rich repeat protein [Solenostemon scutellarioides] Length = 218 Score = 90.1 bits (222), Expect = 2e-16 Identities = 41/54 (75%), Positives = 44/54 (81%) Frame = -3 Query: 163 LLIVLAAHFTSTVSGNSEGDALYALRRSLYDPDKVLQSWDPNLVNPCTWFHITC 2 L +V ++ SGNSEGDALYALRRSL DPD VLQSWDPNLVNPCTWFHITC Sbjct: 13 LTMVSSSLHLQKASGNSEGDALYALRRSLTDPDSVLQSWDPNLVNPCTWFHITC 66