BLASTX nr result
ID: Atractylodes21_contig00003532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00003532 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADZ24000.1| allene oxide synthase [Artemisia annua] 65 8e-09 sp|Q40778.2|C74A2_PARAR RecName: Full=Allene oxide synthase; Alt... 60 1e-07 emb|CAC86897.1| allene oxide synthase [Medicago truncatula] 57 1e-06 >gb|ADZ24000.1| allene oxide synthase [Artemisia annua] Length = 526 Score = 64.7 bits (156), Expect = 8e-09 Identities = 32/61 (52%), Positives = 40/61 (65%) Frame = -3 Query: 183 RLTTAVRRSTLSSKDPSATSQTYREVETTTDLPLQDIPGSYGIPFIQPIKDRFEYFYGTG 4 R T +R S +S D + T+ T +LP++ IPGSYGIPF QP+KDRFEYFYG G Sbjct: 29 RRPTTIRFSA-TSPDTTTTTTTTGSNTDNKNLPIRPIPGSYGIPFYQPLKDRFEYFYGPG 87 Query: 3 G 1 G Sbjct: 88 G 88 >sp|Q40778.2|C74A2_PARAR RecName: Full=Allene oxide synthase; AltName: Full=Cytochrome P450 74A2; AltName: Full=Rubber particle protein; Short=RPP gi|206582008|pdb|3DAM|A Chain A, Crystal Structure Of Allene Oxide Synthase gi|206582009|pdb|3DAN|A Chain A, Crystal Structure Of Allene Oxide Synthase gi|206582010|pdb|3DBM|A Chain A, Crystal Structure Of Allene Oxide Synthase gi|198446807|emb|CAA55025.2| rubber particle protein [Parthenium argentatum] Length = 473 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 87 PLQDIPGSYGIPFIQPIKDRFEYFYGTGG 1 PL++IPGSYGIPF QPIKDR EYFYGTGG Sbjct: 7 PLREIPGSYGIPFFQPIKDRLEYFYGTGG 35 >emb|CAC86897.1| allene oxide synthase [Medicago truncatula] Length = 524 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -3 Query: 162 RSTLSSKDPSATSQTYREVETTTDLPLQDIPGSYGIPFIQPIKDRFEYFYGTG 4 RS++S K P S + + TT LP++ IPG YGIPFIQP KDR +YFY G Sbjct: 37 RSSVSEKPPFQVSISQPQ---TTKLPIRKIPGDYGIPFIQPYKDRLDYFYNQG 86