BLASTX nr result
ID: Atractylodes21_contig00001704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00001704 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320523.1| predicted protein [Populus trichocarpa] gi|2... 98 6e-19 ref|NP_193190.1| nuclear transcription factor Y subunit B-3 [Ara... 96 4e-18 ref|XP_002870307.1| CCAAT-box binding transcription factor subun... 96 4e-18 ref|XP_002531012.1| ccaat-binding transcription factor subunit A... 96 4e-18 ref|XP_003634760.1| PREDICTED: nuclear transcription factor Y su... 95 7e-18 >ref|XP_002320523.1| predicted protein [Populus trichocarpa] gi|222861296|gb|EEE98838.1| predicted protein [Populus trichocarpa] Length = 177 Score = 98.2 bits (243), Expect = 6e-19 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -2 Query: 160 MADSDNESGGHNAGGDLSAREQDRFLPIANVSRIMKKALPANAKISKDAKETV 2 MADSDNESGGHNA +LSA+EQDRFLPIANVSRIMKKALPANAKISKDAKETV Sbjct: 1 MADSDNESGGHNAVSELSAKEQDRFLPIANVSRIMKKALPANAKISKDAKETV 53 >ref|NP_193190.1| nuclear transcription factor Y subunit B-3 [Arabidopsis thaliana] gi|75219213|sp|O23310.1|NFYB3_ARATH RecName: Full=Nuclear transcription factor Y subunit B-3; Short=AtNF-YB-3; AltName: Full=Transcriptional activator HAP3C gi|2244810|emb|CAB10233.1| CCAAT-binding transcription factor subunit A(CBF-A) [Arabidopsis thaliana] gi|7268160|emb|CAB78496.1| CCAAT-binding transcription factor subunit A(CBF-A) [Arabidopsis thaliana] gi|26450702|dbj|BAC42460.1| putative CCAAT-binding transcription factor subunit A CBF-A [Arabidopsis thaliana] gi|28372860|gb|AAO39912.1| At4g14540 [Arabidopsis thaliana] gi|332658058|gb|AEE83458.1| nuclear transcription factor Y subunit B-3 [Arabidopsis thaliana] Length = 161 Score = 95.5 bits (236), Expect = 4e-18 Identities = 47/53 (88%), Positives = 49/53 (92%) Frame = -2 Query: 160 MADSDNESGGHNAGGDLSAREQDRFLPIANVSRIMKKALPANAKISKDAKETV 2 MADSDN+SGGH GG+ S REQDRFLPIANVSRIMKKALPANAKISKDAKETV Sbjct: 1 MADSDNDSGGHKDGGNASTREQDRFLPIANVSRIMKKALPANAKISKDAKETV 53 >ref|XP_002870307.1| CCAAT-box binding transcription factor subunit B (NF-YB) family [Arabidopsis lyrata subsp. lyrata] gi|297316143|gb|EFH46566.1| CCAAT-box binding transcription factor subunit B (NF-YB) family [Arabidopsis lyrata subsp. lyrata] Length = 161 Score = 95.5 bits (236), Expect = 4e-18 Identities = 47/53 (88%), Positives = 49/53 (92%) Frame = -2 Query: 160 MADSDNESGGHNAGGDLSAREQDRFLPIANVSRIMKKALPANAKISKDAKETV 2 MADSDN+SGGH GG+ S REQDRFLPIANVSRIMKKALPANAKISKDAKETV Sbjct: 1 MADSDNDSGGHKDGGNASTREQDRFLPIANVSRIMKKALPANAKISKDAKETV 53 >ref|XP_002531012.1| ccaat-binding transcription factor subunit A, putative [Ricinus communis] gi|223529410|gb|EEF31372.1| ccaat-binding transcription factor subunit A, putative [Ricinus communis] Length = 182 Score = 95.5 bits (236), Expect = 4e-18 Identities = 50/55 (90%), Positives = 51/55 (92%), Gaps = 2/55 (3%) Frame = -2 Query: 160 MADSDNESGGHN--AGGDLSAREQDRFLPIANVSRIMKKALPANAKISKDAKETV 2 MADSDNESGGHN A +LSAREQDRFLPIANVSRIMKKALPANAKISKDAKETV Sbjct: 1 MADSDNESGGHNNNANSELSAREQDRFLPIANVSRIMKKALPANAKISKDAKETV 55 >ref|XP_003634760.1| PREDICTED: nuclear transcription factor Y subunit B-3 [Vitis vinifera] gi|296089911|emb|CBI39730.3| unnamed protein product [Vitis vinifera] Length = 210 Score = 94.7 bits (234), Expect = 7e-18 Identities = 49/55 (89%), Positives = 51/55 (92%), Gaps = 2/55 (3%) Frame = -2 Query: 160 MADSDNESGGHN--AGGDLSAREQDRFLPIANVSRIMKKALPANAKISKDAKETV 2 MADSDN+SGGHN AG +LS REQDRFLPIANVSRIMKKALPANAKISKDAKETV Sbjct: 1 MADSDNDSGGHNNNAGSELSPREQDRFLPIANVSRIMKKALPANAKISKDAKETV 55