BLASTX nr result
ID: Atractylodes21_contig00000237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00000237 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX12792.1| hypothetical protein 2_8478_01 [Pinus taeda] 82 5e-14 gb|AEX12787.1| hypothetical protein 2_8478_01 [Pinus taeda] 82 5e-14 ref|XP_002523054.1| ATP binding protein, putative [Ricinus commu... 81 8e-14 ref|XP_002321014.1| predicted protein [Populus trichocarpa] gi|2... 81 8e-14 ref|XP_002301474.1| predicted protein [Populus trichocarpa] gi|2... 81 8e-14 >gb|AEX12792.1| hypothetical protein 2_8478_01 [Pinus taeda] Length = 127 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 381 YAHDQVCASVSSESANMSELLQWNELYGEGGSRKKKLLSYFM 256 YAH+QVCASVSSESANM+ELLQWN+LYGEGGSR+KK LSYFM Sbjct: 86 YAHEQVCASVSSESANMTELLQWNDLYGEGGSRRKKALSYFM 127 >gb|AEX12787.1| hypothetical protein 2_8478_01 [Pinus taeda] Length = 127 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 381 YAHDQVCASVSSESANMSELLQWNELYGEGGSRKKKLLSYFM 256 YAH+QVCASVSSESANM+ELLQWN+LYGEGGSR+KK LSYFM Sbjct: 86 YAHEQVCASVSSESANMTELLQWNDLYGEGGSRRKKALSYFM 127 >ref|XP_002523054.1| ATP binding protein, putative [Ricinus communis] gi|223537616|gb|EEF39239.1| ATP binding protein, putative [Ricinus communis] Length = 1181 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 381 YAHDQVCASVSSESANMSELLQWNELYGEGGSRKKKLLSYFM 256 YAH+QVCASVSSES NM+ELLQWN+LYGEGGSRKKK LSYFM Sbjct: 1140 YAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKKSLSYFM 1181 >ref|XP_002321014.1| predicted protein [Populus trichocarpa] gi|222861787|gb|EEE99329.1| predicted protein [Populus trichocarpa] Length = 1231 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 381 YAHDQVCASVSSESANMSELLQWNELYGEGGSRKKKLLSYFM 256 YAH+QVCASVSSES NM+ELLQWN+LYGEGGSRKKK LSYFM Sbjct: 1190 YAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKKSLSYFM 1231 >ref|XP_002301474.1| predicted protein [Populus trichocarpa] gi|222843200|gb|EEE80747.1| predicted protein [Populus trichocarpa] Length = 1223 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 381 YAHDQVCASVSSESANMSELLQWNELYGEGGSRKKKLLSYFM 256 YAH+QVCASVSSES NM+ELLQWN+LYGEGGSRKKK LSYFM Sbjct: 1182 YAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKKSLSYFM 1223