BLASTX nr result
ID: Atractylodes21_contig00000010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00000010 (1091 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001189710.1| RabGAP/TBC domain-containing protein [Arabid... 56 7e-15 ref|NP_181460.3| RabGAP/TBC domain-containing protein [Arabidops... 56 7e-15 ref|XP_002315267.1| predicted protein [Populus trichocarpa] gi|2... 55 1e-14 tpg|DAA44781.1| TPA: hypothetical protein ZEAMMB73_028041 [Zea m... 54 3e-14 tpg|DAA44782.1| TPA: hypothetical protein ZEAMMB73_028041 [Zea m... 54 3e-14 >ref|NP_001189710.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|330254560|gb|AEC09654.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] Length = 772 Score = 56.2 bits (134), Expect(2) = 7e-15 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 8/53 (15%) Frame = +3 Query: 3 ACV*GVGWFL------LP--PVLRVWDVLLFQGSRVMLFRTTVALMELYGICL 137 ACV G WFL LP VLRVWDVLLF+G+RVMLFRT +ALME YG L Sbjct: 436 ACVTGP-WFLTIFINMLPWESVLRVWDVLLFEGNRVMLFRTALALMEFYGPAL 487 Score = 51.2 bits (121), Expect(2) = 7e-15 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = +1 Query: 241 FVGPALVTTKDTGDAITLLQSLAG*TFDSMNL---HCVGH 351 F GPALVTTKD GDA+TLLQS+ G TFDS L C+G+ Sbjct: 482 FYGPALVTTKDIGDAVTLLQSMTGSTFDSSQLVFTACMGY 521 >ref|NP_181460.3| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|330254559|gb|AEC09653.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] Length = 749 Score = 56.2 bits (134), Expect(2) = 7e-15 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 8/53 (15%) Frame = +3 Query: 3 ACV*GVGWFL------LP--PVLRVWDVLLFQGSRVMLFRTTVALMELYGICL 137 ACV G WFL LP VLRVWDVLLF+G+RVMLFRT +ALME YG L Sbjct: 408 ACVTGP-WFLTIFINMLPWESVLRVWDVLLFEGNRVMLFRTALALMEFYGPAL 459 Score = 51.2 bits (121), Expect(2) = 7e-15 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = +1 Query: 241 FVGPALVTTKDTGDAITLLQSLAG*TFDSMNL---HCVGH 351 F GPALVTTKD GDA+TLLQS+ G TFDS L C+G+ Sbjct: 454 FYGPALVTTKDIGDAVTLLQSMTGSTFDSSQLVFTACMGY 493 >ref|XP_002315267.1| predicted protein [Populus trichocarpa] gi|222864307|gb|EEF01438.1| predicted protein [Populus trichocarpa] Length = 772 Score = 54.7 bits (130), Expect(2) = 1e-14 Identities = 30/46 (65%), Positives = 34/46 (73%), Gaps = 8/46 (17%) Frame = +3 Query: 24 WFL------LP--PVLRVWDVLLFQGSRVMLFRTTVALMELYGICL 137 WFL LP VLRVWDVLL++G+RVMLFRT +ALMELYG L Sbjct: 419 WFLSIFMNMLPWESVLRVWDVLLYEGNRVMLFRTALALMELYGPAL 464 Score = 52.0 bits (123), Expect(2) = 1e-14 Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 3/38 (7%) Frame = +1 Query: 247 GPALVTTKDTGDAITLLQSLAG*TFDSMNL---HCVGH 351 GPALVTTKD GDA+TLLQSLAG TFDS L C+G+ Sbjct: 461 GPALVTTKDAGDAVTLLQSLAGSTFDSSQLVFTACMGY 498 >tpg|DAA44781.1| TPA: hypothetical protein ZEAMMB73_028041 [Zea mays] Length = 870 Score = 53.9 bits (128), Expect(2) = 3e-14 Identities = 27/46 (58%), Positives = 35/46 (76%), Gaps = 8/46 (17%) Frame = +3 Query: 24 WFL------LP--PVLRVWDVLLFQGSRVMLFRTTVALMELYGICL 137 WFL LP VLR+WDV+LF+G+R+MLFRTT+AL++LYG L Sbjct: 493 WFLSIFINMLPWESVLRIWDVILFEGNRIMLFRTTLALLDLYGPAL 538 Score = 51.6 bits (122), Expect(2) = 3e-14 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +1 Query: 247 GPALVTTKDTGDAITLLQSLAG*TFDSMNL 336 GPALVTTKD GDAITLLQSLAG TFDS L Sbjct: 535 GPALVTTKDAGDAITLLQSLAGSTFDSSQL 564 >tpg|DAA44782.1| TPA: hypothetical protein ZEAMMB73_028041 [Zea mays] Length = 866 Score = 53.9 bits (128), Expect(2) = 3e-14 Identities = 27/46 (58%), Positives = 35/46 (76%), Gaps = 8/46 (17%) Frame = +3 Query: 24 WFL------LP--PVLRVWDVLLFQGSRVMLFRTTVALMELYGICL 137 WFL LP VLR+WDV+LF+G+R+MLFRTT+AL++LYG L Sbjct: 488 WFLSIFINMLPWESVLRIWDVILFEGNRIMLFRTTLALLDLYGPAL 533 Score = 51.6 bits (122), Expect(2) = 3e-14 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +1 Query: 247 GPALVTTKDTGDAITLLQSLAG*TFDSMNL 336 GPALVTTKD GDAITLLQSLAG TFDS L Sbjct: 530 GPALVTTKDAGDAITLLQSLAGSTFDSSQL 559