BLASTX nr result
ID: Astragalus24_contig00030094
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00030094 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013449582.1| F-box protein interaction domain protein [Me... 79 1e-14 ref|XP_003612244.2| F-box protein interaction domain protein [Me... 78 5e-14 ref|XP_013453551.1| F-box protein interaction domain protein [Me... 77 1e-13 gb|PNX81323.1| F-box protein [Trifolium pratense] 70 1e-12 ref|XP_003612153.1| F-box protein interaction domain protein [Me... 72 5e-12 ref|XP_003612169.2| F-box protein interaction domain protein [Me... 71 2e-11 gb|PNX88716.1| F-box family protein [Trifolium pratense] 69 4e-11 gb|AFK40065.1| unknown [Medicago truncatula] 70 4e-11 ref|XP_003610871.2| F-box protein interaction domain protein [Me... 69 8e-11 ref|XP_013453553.1| F-box protein interaction domain protein [Me... 68 2e-10 ref|XP_004512128.1| PREDICTED: F-box protein At3g07870-like [Cic... 67 3e-10 ref|XP_003612151.2| F-box protein interaction domain protein [Me... 67 3e-10 gb|AFK37781.1| unknown [Lotus japonicus] 67 5e-10 ref|XP_003612229.2| F-box protein interaction domain protein [Me... 65 1e-09 ref|XP_019454515.1| PREDICTED: F-box/kelch-repeat protein At3g06... 65 2e-09 ref|XP_013455133.1| F-box protein interaction domain protein [Me... 65 2e-09 gb|PNY09680.1| F-box family protein [Trifolium pratense] 64 4e-09 dbj|GAU36234.1| hypothetical protein TSUD_214310 [Trifolium subt... 64 5e-09 ref|XP_013453552.1| F-box protein interaction domain protein [Me... 64 6e-09 ref|XP_003625089.2| F-box protein interaction domain protein, pa... 63 8e-09 >ref|XP_013449582.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH23610.1| F-box protein interaction domain protein [Medicago truncatula] Length = 305 Score = 78.6 bits (192), Expect = 1e-14 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 2/59 (3%) Frame = -2 Query: 422 GYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVLFV 252 GYK+ R+ G +SKS EVIPHIPSL+SLKDVV GDNI V +++SRC +KL EE EVLF+ Sbjct: 242 GYKVFRIRGTRSKSVEVIPHIPSLISLKDVVKGDNIEVFSIHSRCAKYKLWEESEVLFL 300 >ref|XP_003612244.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95202.2| F-box protein interaction domain protein [Medicago truncatula] Length = 482 Score = 78.2 bits (191), Expect = 5e-14 Identities = 38/57 (66%), Positives = 48/57 (84%), Gaps = 2/57 (3%) Frame = -2 Query: 422 GYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 258 G+K+ R+ G+ SK FEVIPHIPSL+SLKDV+ GDNI VLN++SRC FKL+EE +VL Sbjct: 419 GFKVFRIHGSHSKFFEVIPHIPSLISLKDVLKGDNIEVLNIHSRCAKFKLREERDVL 475 >ref|XP_013453551.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH27584.1| F-box protein interaction domain protein [Medicago truncatula] Length = 496 Score = 77.0 bits (188), Expect = 1e-13 Identities = 37/57 (64%), Positives = 47/57 (82%), Gaps = 2/57 (3%) Frame = -2 Query: 422 GYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 258 G+++ R+ G+ S FEVIPHIPSL+SLKDV+ GDNI VLN++SRC FKL+EE EVL Sbjct: 430 GFEVFRIYGSSSNFFEVIPHIPSLISLKDVLKGDNIEVLNIHSRCAKFKLREEKEVL 486 >gb|PNX81323.1| F-box protein [Trifolium pratense] Length = 131 Score = 70.1 bits (170), Expect = 1e-12 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 2/57 (3%) Frame = -2 Query: 416 KLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVLFV 252 K+ ++ G +S S VIPHIPSL+SLKDVV GDNI VL+++SRC FKL++E+EVLF+ Sbjct: 61 KVFQIRGTRSTSVGVIPHIPSLISLKDVVKGDNIEVLSIHSRCAKFKLQKENEVLFL 117 >ref|XP_003612153.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES95111.1| F-box protein interaction domain protein [Medicago truncatula] Length = 507 Score = 72.4 bits (176), Expect = 5e-12 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 4/61 (6%) Frame = -2 Query: 422 GYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC----FKLKEEDEVLF 255 G+++ R+ G+ S FEVIPHIPSL+SLKDV+ GDNI VLN++SRC F L EE+E L Sbjct: 430 GFEVFRIYGSSSNFFEVIPHIPSLISLKDVLKGDNIEVLNIHSRCVFKFFNLHEENEDLV 489 Query: 254 V 252 V Sbjct: 490 V 490 >ref|XP_003612169.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95127.2| F-box protein interaction domain protein [Medicago truncatula] Length = 490 Score = 70.9 bits (172), Expect = 2e-11 Identities = 34/57 (59%), Positives = 45/57 (78%), Gaps = 2/57 (3%) Frame = -2 Query: 422 GYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 258 G+K+ R+ G S+ E+IPH+PSL+SLKDVV GDNI VLN++SRC +L EE+EVL Sbjct: 427 GFKVFRIQGTSSEFVEIIPHVPSLISLKDVVKGDNIEVLNIHSRCANVELPEENEVL 483 >gb|PNX88716.1| F-box family protein [Trifolium pratense] Length = 272 Score = 68.9 bits (167), Expect = 4e-11 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = -2 Query: 425 NGYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEV 261 N +K+ + G S EVI HIPSL+SLKDVV GDNI VLN++SRC FKL+EE+EV Sbjct: 197 NQFKVFEIQGTHSDFVEVISHIPSLISLKDVVKGDNIEVLNIHSRCAKFKLREENEV 253 >gb|AFK40065.1| unknown [Medicago truncatula] Length = 479 Score = 69.7 bits (169), Expect = 4e-11 Identities = 35/57 (61%), Positives = 45/57 (78%), Gaps = 2/57 (3%) Frame = -2 Query: 422 GYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 258 G+K+ R+ G++ FEVIPHIPSL+SLKDV+ G NI VLN++SRC FKL+ E EVL Sbjct: 416 GFKVFRIHGSRINYFEVIPHIPSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKEVL 472 >ref|XP_003610871.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES93829.2| F-box protein interaction domain protein [Medicago truncatula] Length = 448 Score = 68.9 bits (167), Expect = 8e-11 Identities = 34/55 (61%), Positives = 43/55 (78%), Gaps = 2/55 (3%) Frame = -2 Query: 416 KLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 258 K + G++S FE+IPHIPSL+SLKDV+ GDNI VLN++SRC FKL+EE E L Sbjct: 387 KAFEIHGSRSDCFEIIPHIPSLISLKDVLKGDNIEVLNIHSRCAKFKLREETEGL 441 >ref|XP_013453553.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH27586.1| F-box protein interaction domain protein [Medicago truncatula] Length = 459 Score = 67.8 bits (164), Expect = 2e-10 Identities = 32/58 (55%), Positives = 45/58 (77%), Gaps = 2/58 (3%) Frame = -2 Query: 425 NGYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 258 + +K+ R+ G S+ E+IPH+PSL+SLKDVV GDN +LN++SRC KL+EE+EVL Sbjct: 395 HAFKVFRIHGISSEFVEIIPHVPSLISLKDVVKGDNTEMLNIHSRCANVKLEEENEVL 452 >ref|XP_004512128.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] ref|XP_004512171.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] ref|XP_012574463.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] ref|XP_012574465.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] Length = 488 Score = 67.4 bits (163), Expect = 3e-10 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = -2 Query: 380 FEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 258 FEVIPHIPSL+SLKDVV GDNI VLN++SRC FKL EE+EVL Sbjct: 430 FEVIPHIPSLISLKDVVKGDNIEVLNIHSRCTKFKLPEENEVL 472 >ref|XP_003612151.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95109.2| F-box protein interaction domain protein [Medicago truncatula] Length = 512 Score = 67.4 bits (163), Expect = 3e-10 Identities = 34/57 (59%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = -2 Query: 422 GYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 258 G+K+ R+ G++ FEVIPHIPSL+SLKDV+ G NI VLN++SRC FKL+ E E L Sbjct: 416 GFKVFRIHGSRINYFEVIPHIPSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKESL 472 >gb|AFK37781.1| unknown [Lotus japonicus] Length = 489 Score = 66.6 bits (161), Expect = 5e-10 Identities = 36/60 (60%), Positives = 46/60 (76%), Gaps = 2/60 (3%) Frame = -2 Query: 425 NGYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVLFV 252 +G+K+ +V G QS+ F+VIPHIPS +SLKDVV GDNI VLNV+SR FK EE+ LF+ Sbjct: 412 DGFKIFKVRGTQSR-FDVIPHIPSFISLKDVVKGDNIEVLNVHSRYEEFKFMEENADLFL 470 >ref|XP_003612229.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95187.2| F-box protein interaction domain protein [Medicago truncatula] Length = 423 Score = 65.5 bits (158), Expect = 1e-09 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 3/55 (5%) Frame = -2 Query: 416 KLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNS-RC--FKLKEEDEV 261 ++ +V GAQSK EVIPHIPSL+SLK+ V GDN+ VLNV S RC FKL+EE EV Sbjct: 339 RVFQVHGAQSKLVEVIPHIPSLISLKEAVNGDNVEVLNVYSRRCAKFKLREESEV 393 >ref|XP_019454515.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like isoform X1 [Lupinus angustifolius] Length = 468 Score = 65.1 bits (157), Expect = 2e-09 Identities = 33/57 (57%), Positives = 45/57 (78%), Gaps = 2/57 (3%) Frame = -2 Query: 416 KLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVLFV 252 K ++ G++S +FEV PHIPSL+SLKD V G+N+ VLNV+ RC FKL+EE+E LF+ Sbjct: 412 KYFKIRGSKS-NFEVFPHIPSLISLKDAVKGNNVEVLNVHLRCAKFKLREENEALFL 467 >ref|XP_013455133.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH29181.1| F-box protein interaction domain protein [Medicago truncatula] Length = 520 Score = 65.1 bits (157), Expect = 2e-09 Identities = 33/57 (57%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = -2 Query: 422 GYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 258 G+K+ R+ G++ FEVI HIPSL+SLKDV+ G NI VLN++SRC FKL+ E E L Sbjct: 416 GFKVFRIHGSRKNYFEVIQHIPSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKESL 472 >gb|PNY09680.1| F-box family protein [Trifolium pratense] Length = 478 Score = 63.9 bits (154), Expect = 4e-09 Identities = 30/43 (69%), Positives = 37/43 (86%), Gaps = 2/43 (4%) Frame = -2 Query: 380 FEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 258 FE+IPHIPSL+SLKDV+ GDNI V N++SRC FKL+EE+E L Sbjct: 371 FEIIPHIPSLISLKDVIKGDNIEVQNIHSRCAKFKLREENETL 413 >dbj|GAU36234.1| hypothetical protein TSUD_214310 [Trifolium subterraneum] Length = 357 Score = 63.5 bits (153), Expect = 5e-09 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = -2 Query: 425 NGYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEE 270 N K V G Q K EVIPHIPSL+SLKD V DN+ VLNVNSRC FKL EE Sbjct: 304 NRPKQFLVCGTQEKLLEVIPHIPSLISLKDAVRRDNVDVLNVNSRCAKFKLPEE 357 >ref|XP_013453552.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH27585.1| F-box protein interaction domain protein [Medicago truncatula] Length = 473 Score = 63.5 bits (153), Expect = 6e-09 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -2 Query: 422 GYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNSR 291 G+++ R+ G+ S FEVIPHIPSL+SLKDV+ GDNI VLN++SR Sbjct: 430 GFEVFRIYGSSSNFFEVIPHIPSLISLKDVLKGDNIEVLNIHSR 473 >ref|XP_003625089.2| F-box protein interaction domain protein, partial [Medicago truncatula] gb|AES81307.2| F-box protein interaction domain protein, partial [Medicago truncatula] Length = 428 Score = 63.2 bits (152), Expect = 8e-09 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -2 Query: 422 GYKLLRVIGAQSKSFEVIPHIPSLVSLKDVVIGDNIRVLNVNS 294 GYK+ R+ G +SKS EVIPHIPSL+SLKDVV GDNI V +++S Sbjct: 386 GYKVFRIRGTRSKSVEVIPHIPSLISLKDVVKGDNIEVFSIHS 428