BLASTX nr result
ID: Astragalus24_contig00022742
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00022742 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMO96391.1| hypothetical protein COLO4_15301 [Corchorus olito... 55 3e-06 >gb|OMO96391.1| hypothetical protein COLO4_15301 [Corchorus olitorius] Length = 631 Score = 55.5 bits (132), Expect = 3e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +2 Query: 254 EREFSY*ISDMEQYEILEQIGKGAFGSALLVRH 352 ERE Y IS MEQYEILEQIGKGAFGSALLVRH Sbjct: 4 EREVKY-ISQMEQYEILEQIGKGAFGSALLVRH 35