BLASTX nr result
ID: Astragalus24_contig00008521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00008521 (326 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016203950.1| ferredoxin-thioredoxin reductase, variable c... 76 5e-15 ref|XP_015966222.1| ferredoxin-thioredoxin reductase, variable c... 76 6e-15 ref|XP_016200478.2| ferredoxin-thioredoxin reductase, variable c... 76 6e-15 gb|AFK46976.1| unknown [Lotus japonicus] 75 8e-15 dbj|BAU00894.1| hypothetical protein VIGAN_11003000 [Vigna angul... 69 7e-13 ref|XP_019421135.1| PREDICTED: ferredoxin-thioredoxin reductase,... 70 7e-13 ref|XP_017405545.1| PREDICTED: ferredoxin-thioredoxin reductase,... 69 1e-12 ref|XP_020206728.1| ferredoxin-thioredoxin reductase, variable c... 69 2e-12 gb|OVA10757.1| Lipoyl synthase [Macleaya cordata] 68 6e-12 ref|XP_014510317.1| ferredoxin-thioredoxin reductase, variable c... 68 6e-12 ref|XP_008340405.1| PREDICTED: ferredoxin-thioredoxin reductase,... 68 8e-12 ref|XP_018836471.1| PREDICTED: ferredoxin-thioredoxin reductase,... 68 8e-12 ref|XP_010276155.1| PREDICTED: ferredoxin-thioredoxin reductase,... 68 1e-11 ref|XP_009351780.1| PREDICTED: ferredoxin-thioredoxin reductase,... 67 1e-11 gb|PNX67751.1| ferredoxin-thioredoxin reductase variable chain-l... 66 2e-11 ref|XP_004489188.1| PREDICTED: ferredoxin-thioredoxin reductase,... 65 3e-11 ref|XP_013450699.1| ferredoxin-thioredoxin reductase, variable c... 65 3e-11 ref|XP_008389050.1| PREDICTED: ferredoxin-thioredoxin reductase,... 65 6e-11 ref|XP_022763870.1| ferredoxin-thioredoxin reductase, variable c... 65 6e-11 ref|XP_021286778.1| ferredoxin-thioredoxin reductase, variable c... 65 6e-11 >ref|XP_016203950.1| ferredoxin-thioredoxin reductase, variable chain [Arachis ipaensis] Length = 164 Score = 75.9 bits (185), Expect = 5e-15 Identities = 41/84 (48%), Positives = 50/84 (59%), Gaps = 4/84 (4%) Frame = -2 Query: 241 SPSSIRPPSTALCXXXXXXXXXRSIIRCEVAVE----EXXXXXXXXSADKVGARVRVKVP 74 +P S+ PS AL ++RCEVAV+ + KVGARVRVK P Sbjct: 38 NPLSLPQPSRALSLPTPTRRPLTGLVRCEVAVQLSSQQDEEAEESSKVSKVGARVRVKSP 97 Query: 73 LKVYHISKVPEVDLTGMEGEIKQY 2 LKVYH+ KVPE+DL GMEG+IKQY Sbjct: 98 LKVYHVPKVPELDLDGMEGQIKQY 121 >ref|XP_015966222.1| ferredoxin-thioredoxin reductase, variable chain [Arachis duranensis] Length = 168 Score = 75.9 bits (185), Expect = 6e-15 Identities = 41/84 (48%), Positives = 50/84 (59%), Gaps = 4/84 (4%) Frame = -2 Query: 241 SPSSIRPPSTALCXXXXXXXXXRSIIRCEVAVE----EXXXXXXXXSADKVGARVRVKVP 74 +P S+ PS AL ++RCEVAV+ + KVGARVRVK P Sbjct: 42 NPLSLPQPSRALSLPTPTRRPLTGLVRCEVAVQLSSQQDEEAEESSKVSKVGARVRVKSP 101 Query: 73 LKVYHISKVPEVDLTGMEGEIKQY 2 LKVYH+ KVPE+DL GMEG+IKQY Sbjct: 102 LKVYHVPKVPELDLDGMEGQIKQY 125 >ref|XP_016200478.2| ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Arachis ipaensis] Length = 169 Score = 75.9 bits (185), Expect = 6e-15 Identities = 41/84 (48%), Positives = 50/84 (59%), Gaps = 4/84 (4%) Frame = -2 Query: 241 SPSSIRPPSTALCXXXXXXXXXRSIIRCEVAVE----EXXXXXXXXSADKVGARVRVKVP 74 +P S+ PS AL ++RCEVAV+ + KVGARVRVK P Sbjct: 40 NPLSLPQPSCALSLPTPTRRPLTGLVRCEVAVQLSSQQDEEAEESSKVSKVGARVRVKSP 99 Query: 73 LKVYHISKVPEVDLTGMEGEIKQY 2 LKVYH+ KVPE+DL GMEG+IKQY Sbjct: 100 LKVYHVPKVPELDLDGMEGQIKQY 123 >gb|AFK46976.1| unknown [Lotus japonicus] Length = 166 Score = 75.5 bits (184), Expect = 8e-15 Identities = 49/87 (56%), Positives = 52/87 (59%), Gaps = 7/87 (8%) Frame = -2 Query: 241 SPSSIRPPSTALCXXXXXXXXXRSIIRCEVAVEEXXXXXXXXSAD-------KVGARVRV 83 S SSI PP A RSI RCEVAVEE S++ KVGARVRV Sbjct: 42 SSSSIHPPLFA-----NLRGSSRSITRCEVAVEESSPSSTSSSSESEEAESSKVGARVRV 96 Query: 82 KVPLKVYHISKVPEVDLTGMEGEIKQY 2 KVPLKVYH+ KVPE DL G EGEIKQY Sbjct: 97 KVPLKVYHVPKVPEFDLEGAEGEIKQY 123 >dbj|BAU00894.1| hypothetical protein VIGAN_11003000 [Vigna angularis var. angularis] Length = 117 Score = 69.3 bits (168), Expect = 7e-13 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = -2 Query: 166 IRCEVAVEEXXXXXXXXSADKVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 +RCEVA+ A KVGARV+VKV +KVYH+ KVPE+DLTGMEGEIKQY Sbjct: 46 VRCEVAINAVEESTTSAEA-KVGARVKVKVGVKVYHVPKVPELDLTGMEGEIKQY 99 >ref|XP_019421135.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Lupinus angustifolius] ref|XP_019442496.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Lupinus angustifolius] gb|OIV94180.1| hypothetical protein TanjilG_13797 [Lupinus angustifolius] gb|OIW12358.1| hypothetical protein TanjilG_04107 [Lupinus angustifolius] Length = 166 Score = 70.5 bits (171), Expect = 7e-13 Identities = 38/60 (63%), Positives = 41/60 (68%), Gaps = 3/60 (5%) Frame = -2 Query: 172 SIIRCEVAVEEXXXXXXXXSAD---KVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 SIIRCEVA E K+GARV+VKVPLKVYHI KV E DLTG+EGEIKQY Sbjct: 65 SIIRCEVAAAEVSTSSPDDQEQEESKIGARVKVKVPLKVYHIPKVAEFDLTGLEGEIKQY 124 >ref|XP_017405545.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Vigna angularis] gb|KOM25362.1| hypothetical protein LR48_Vigan102s002000 [Vigna angularis] Length = 142 Score = 69.3 bits (168), Expect = 1e-12 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = -2 Query: 166 IRCEVAVEEXXXXXXXXSADKVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 +RCEVA+ A KVGARV+VKV +KVYH+ KVPE+DLTGMEGEIKQY Sbjct: 46 VRCEVAINAVEESTTSAEA-KVGARVKVKVGVKVYHVPKVPELDLTGMEGEIKQY 99 >ref|XP_020206728.1| ferredoxin-thioredoxin reductase, variable chain-like [Cajanus cajan] gb|KYP34874.1| Ferredoxin-thioredoxin reductase, variable chain [Cajanus cajan] Length = 143 Score = 68.6 bits (166), Expect = 2e-12 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = -2 Query: 172 SIIRCEVAVEEXXXXXXXXSADKVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 +IIRCEVA+ ++GARV+VKVPLKVYH+ K+ E+DLTGMEGEIKQY Sbjct: 48 NIIRCEVAINAVEESTTL----QIGARVKVKVPLKVYHVPKIGELDLTGMEGEIKQY 100 >gb|OVA10757.1| Lipoyl synthase [Macleaya cordata] Length = 168 Score = 68.2 bits (165), Expect = 6e-12 Identities = 42/94 (44%), Positives = 51/94 (54%), Gaps = 13/94 (13%) Frame = -2 Query: 244 VSPSSIRPPSTALCXXXXXXXXXRSIIRCEVAVE-------------EXXXXXXXXSADK 104 VS SS+RP + II CEVA++ E K Sbjct: 36 VSASSLRP------------RRQQRIISCEVALKPDSAPSISSSAVLEAKEDEDESIQAK 83 Query: 103 VGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 +GARVRVK+PLKVYH+ KVPEVDLTGMEG++KQY Sbjct: 84 IGARVRVKIPLKVYHVPKVPEVDLTGMEGKVKQY 117 >ref|XP_014510317.1| ferredoxin-thioredoxin reductase, variable chain [Vigna radiata var. radiata] Length = 153 Score = 67.8 bits (164), Expect = 6e-12 Identities = 34/55 (61%), Positives = 40/55 (72%) Frame = -2 Query: 166 IRCEVAVEEXXXXXXXXSADKVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 +RCEVA+ A KVGARV+VK +KVYH+ KVPE+DLTGMEGEIKQY Sbjct: 57 VRCEVAINAVEESTTSAEA-KVGARVKVKAGVKVYHVPKVPELDLTGMEGEIKQY 110 >ref|XP_008340405.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Malus domestica] Length = 168 Score = 67.8 bits (164), Expect = 8e-12 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -2 Query: 112 ADKVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 + K+GARVRVKVPLKVYH+ +VPEVD+TGMEGE+KQY Sbjct: 89 SSKIGARVRVKVPLKVYHVPRVPEVDITGMEGELKQY 125 >ref|XP_018836471.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain, chloroplastic [Juglans regia] ref|XP_018836479.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain, chloroplastic [Juglans regia] Length = 190 Score = 68.2 bits (165), Expect = 8e-12 Identities = 33/57 (57%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = -2 Query: 166 IRCEVAVEEXXXXXXXXSAD--KVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 I CE+++E S++ K+GARVRVKVPLKV+H+ ++PEVDLTGMEGE+KQY Sbjct: 91 ISCEISLESDSTTVTRASSEEAKIGARVRVKVPLKVHHVPRLPEVDLTGMEGELKQY 147 >ref|XP_010276155.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Nelumbo nucifera] Length = 182 Score = 67.8 bits (164), Expect = 1e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 106 KVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 K+GARVRVKVPLKVYHI KVPE DLTGMEGE+KQY Sbjct: 100 KIGARVRVKVPLKVYHIPKVPEFDLTGMEGELKQY 134 >ref|XP_009351780.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Pyrus x bretschneideri] Length = 168 Score = 67.4 bits (163), Expect = 1e-11 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -2 Query: 106 KVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 K+GARVRVKVPLKVYH+ +VPEVD+TGMEGE+KQY Sbjct: 91 KIGARVRVKVPLKVYHVPRVPEVDITGMEGELKQY 125 >gb|PNX67751.1| ferredoxin-thioredoxin reductase variable chain-like protein [Trifolium pratense] Length = 135 Score = 65.9 bits (159), Expect = 2e-11 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = -2 Query: 166 IRCEVAVEEXXXXXXXXSADKVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQ 5 IRC+V EE K+GARVRVKVPLKVYH+ KVPE+DLTG EG IKQ Sbjct: 38 IRCDVEGEEGESQT------KIGARVRVKVPLKVYHVPKVPEIDLTGREGHIKQ 85 >ref|XP_004489188.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Cicer arietinum] Length = 129 Score = 65.5 bits (158), Expect = 3e-11 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -2 Query: 169 IIRCEVAVEEXXXXXXXXSADKVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQ 5 +IRCE EE K+GAR+RVKVPLKVYH+ KVPE+DL GMEG IKQ Sbjct: 39 MIRCEEKDEE----------SKIGARIRVKVPLKVYHVPKVPEIDLAGMEGNIKQ 83 >ref|XP_013450699.1| ferredoxin-thioredoxin reductase, variable chain [Medicago truncatula] gb|AFK45060.1| unknown [Medicago truncatula] gb|KEH24727.1| ferredoxin-thioredoxin reductase, variable chain [Medicago truncatula] Length = 135 Score = 65.5 bits (158), Expect = 3e-11 Identities = 33/54 (61%), Positives = 39/54 (72%) Frame = -2 Query: 166 IRCEVAVEEXXXXXXXXSADKVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQ 5 IRC+V E+ K+G+RVRVKVPLKVYH+ KVPEVDLTG EG+IKQ Sbjct: 39 IRCDVGEEDSSSSTA-----KIGSRVRVKVPLKVYHVPKVPEVDLTGREGQIKQ 87 >ref|XP_008389050.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Malus domestica] Length = 164 Score = 65.5 bits (158), Expect = 6e-11 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -2 Query: 112 ADKVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 + K+GARV VKVPLKVYH+ +VPEVD+TGMEGE+KQY Sbjct: 85 SSKIGARVTVKVPLKVYHVPRVPEVDITGMEGELKQY 121 >ref|XP_022763870.1| ferredoxin-thioredoxin reductase, variable chain-like [Durio zibethinus] Length = 167 Score = 65.5 bits (158), Expect = 6e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 106 KVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 KVGA+VRVKVPLKVYH+ +VPEVDLTGMEG IKQY Sbjct: 90 KVGAKVRVKVPLKVYHVPRVPEVDLTGMEGVIKQY 124 >ref|XP_021286778.1| ferredoxin-thioredoxin reductase, variable chain [Herrania umbratica] Length = 168 Score = 65.5 bits (158), Expect = 6e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 106 KVGARVRVKVPLKVYHISKVPEVDLTGMEGEIKQY 2 KVGA+VRVKVPLKVYH+ +VPEVDLTGMEG IKQY Sbjct: 90 KVGAKVRVKVPLKVYHVPRVPEVDLTGMEGVIKQY 124