BLASTX nr result
ID: Astragalus23_contig00032304
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00032304 (443 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH55997.1| hypothetical protein GLYMA_06G295300 [Glycine max] 55 6e-06 ref|XP_014632295.1| PREDICTED: ethylene-responsive transcription... 55 6e-06 gb|KHN41135.1| Ethylene-responsive transcription factor ERF054 [... 55 6e-06 >gb|KRH55997.1| hypothetical protein GLYMA_06G295300 [Glycine max] Length = 403 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = +2 Query: 188 NNRKSTKEGVDDTP--KVIWSKESHDLEIEKGKGFNFS*GRQQWKP 319 N KSTKEGV++T KVI E D EIEKGKG + S GR+QWKP Sbjct: 4 NREKSTKEGVEETHHHKVIGESEGQDWEIEKGKGLDLSSGRRQWKP 49 >ref|XP_014632295.1| PREDICTED: ethylene-responsive transcription factor ERF054-like [Glycine max] Length = 415 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = +2 Query: 188 NNRKSTKEGVDDTP--KVIWSKESHDLEIEKGKGFNFS*GRQQWKP 319 N KSTKEGV++T KVI E D EIEKGKG + S GR+QWKP Sbjct: 4 NREKSTKEGVEETHHHKVIGESEGQDWEIEKGKGLDLSSGRRQWKP 49 >gb|KHN41135.1| Ethylene-responsive transcription factor ERF054 [Glycine soja] Length = 415 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = +2 Query: 188 NNRKSTKEGVDDTP--KVIWSKESHDLEIEKGKGFNFS*GRQQWKP 319 N KSTKEGV++T KVI E D EIEKGKG + S GR+QWKP Sbjct: 4 NREKSTKEGVEETHHHKVIGESEGQDWEIEKGKGLDLSSGRRQWKP 49