BLASTX nr result
ID: Astragalus23_contig00032017
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00032017 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN10474.1| Receptor-like serine/threonine-protein kinase [Gl... 79 1e-14 ref|XP_020204541.1| receptor-like serine/threonine-protein kinas... 79 2e-14 ref|XP_006599640.1| PREDICTED: receptor-like serine/threonine-pr... 78 3e-14 gb|PNY00783.1| receptor-like serine/threonine-protein kinase [Tr... 78 3e-14 ref|XP_013443559.1| receptor-like Serine/Threonine-kinase plant ... 77 4e-14 gb|KHN31559.1| Receptor-like serine/threonine-protein kinase [Gl... 77 6e-14 gb|KRH09186.1| hypothetical protein GLYMA_16G201500 [Glycine max] 77 6e-14 ref|XP_007152371.1| hypothetical protein PHAVU_004G124400g [Phas... 77 6e-14 ref|XP_022640421.1| receptor-like serine/threonine-protein kinas... 77 6e-14 ref|XP_014510590.2| receptor-like serine/threonine-protein kinas... 77 6e-14 ref|XP_016204158.1| receptor-like serine/threonine-protein kinas... 77 8e-14 ref|XP_015967520.1| receptor-like serine/threonine-protein kinas... 77 8e-14 ref|XP_006587372.1| PREDICTED: receptor-like serine/threonine-pr... 77 8e-14 gb|KRH38666.1| hypothetical protein GLYMA_09G150100 [Glycine max] 76 1e-13 ref|XP_014617669.1| PREDICTED: receptor-like serine/threonine-pr... 76 1e-13 dbj|BAU02432.1| hypothetical protein VIGAN_11196000 [Vigna angul... 76 1e-13 ref|XP_017438575.1| PREDICTED: receptor-like serine/threonine-pr... 76 1e-13 ref|XP_004506300.1| PREDICTED: receptor-like serine/threonine-pr... 76 1e-13 ref|XP_019465045.1| PREDICTED: receptor-like serine/threonine-pr... 75 3e-13 dbj|GAU28890.1| hypothetical protein TSUD_293420 [Trifolium subt... 75 4e-13 >gb|KHN10474.1| Receptor-like serine/threonine-protein kinase [Glycine soja] Length = 435 Score = 79.0 bits (193), Expect = 1e-14 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK*VG 231 SMKEVVGMLSG LEPPQLPVEYSPSTPSRFPFKSRRKG G Sbjct: 352 SMKEVVGMLSGELEPPQLPVEYSPSTPSRFPFKSRRKGSLYG 393 >ref|XP_020204541.1| receptor-like serine/threonine-protein kinase At2g45590 [Cajanus cajan] Length = 634 Score = 78.6 bits (192), Expect = 2e-14 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 SMKEVVGMLSG+LEPPQLPVEYSPSTPSRFPFKSR+KG+ Sbjct: 596 SMKEVVGMLSGDLEPPQLPVEYSPSTPSRFPFKSRKKGR 634 >ref|XP_006599640.1| PREDICTED: receptor-like serine/threonine-protein kinase At4g25390 [Glycine max] Length = 679 Score = 77.8 bits (190), Expect = 3e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 S+KEVVGMLSG LEPPQLPVEYSPSTPSRFPFKSRRKG+ Sbjct: 641 SIKEVVGMLSGELEPPQLPVEYSPSTPSRFPFKSRRKGR 679 >gb|PNY00783.1| receptor-like serine/threonine-protein kinase [Trifolium pratense] Length = 680 Score = 77.8 bits (190), Expect = 3e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 SMKEVVGMLSG LEPPQLPVEYSPSTPSRFPFKSR+KG+ Sbjct: 640 SMKEVVGMLSGELEPPQLPVEYSPSTPSRFPFKSRKKGQ 678 >ref|XP_013443559.1| receptor-like Serine/Threonine-kinase plant [Medicago truncatula] gb|KEH17584.1| receptor-like Serine/Threonine-kinase plant [Medicago truncatula] Length = 687 Score = 77.4 bits (189), Expect = 4e-14 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 SMKEVVGMLSG LEPPQLP+EYSPSTPSRFPFKSR+KG+ Sbjct: 647 SMKEVVGMLSGELEPPQLPIEYSPSTPSRFPFKSRKKGQ 685 >gb|KHN31559.1| Receptor-like serine/threonine-protein kinase [Glycine soja] Length = 560 Score = 77.0 bits (188), Expect = 6e-14 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKG 243 S+KEVVGMLSG LEPPQLPVEYSPSTPSRFPFKSRRKG Sbjct: 477 SIKEVVGMLSGELEPPQLPVEYSPSTPSRFPFKSRRKG 514 >gb|KRH09186.1| hypothetical protein GLYMA_16G201500 [Glycine max] Length = 660 Score = 77.0 bits (188), Expect = 6e-14 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKG 243 S+KEVVGMLSG LEPPQLPVEYSPSTPSRFPFKSRRKG Sbjct: 602 SIKEVVGMLSGELEPPQLPVEYSPSTPSRFPFKSRRKG 639 >ref|XP_007152371.1| hypothetical protein PHAVU_004G124400g [Phaseolus vulgaris] gb|ESW24365.1| hypothetical protein PHAVU_004G124400g [Phaseolus vulgaris] Length = 712 Score = 77.0 bits (188), Expect = 6e-14 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 S+KEVVGMLSG LEPPQLPVEYSPSTPSR+PFKSRRKG+ Sbjct: 626 SLKEVVGMLSGELEPPQLPVEYSPSTPSRYPFKSRRKGR 664 >ref|XP_022640421.1| receptor-like serine/threonine-protein kinase At4g25390 isoform X2 [Vigna radiata var. radiata] Length = 728 Score = 77.0 bits (188), Expect = 6e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 SMKEVVGMLSG LEPPQLPVEYSPSTPSR+PFKSRRKG+ Sbjct: 622 SMKEVVGMLSGVLEPPQLPVEYSPSTPSRYPFKSRRKGR 660 >ref|XP_014510590.2| receptor-like serine/threonine-protein kinase At4g25390 isoform X1 [Vigna radiata var. radiata] Length = 739 Score = 77.0 bits (188), Expect = 6e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 SMKEVVGMLSG LEPPQLPVEYSPSTPSR+PFKSRRKG+ Sbjct: 622 SMKEVVGMLSGVLEPPQLPVEYSPSTPSRYPFKSRRKGR 660 >ref|XP_016204158.1| receptor-like serine/threonine-protein kinase At4g25390, partial [Arachis ipaensis] Length = 661 Score = 76.6 bits (187), Expect = 8e-14 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 SMKEVVGMLSG LEPPQLP+EYSPSTPSRFPFK+R+KG+ Sbjct: 623 SMKEVVGMLSGELEPPQLPIEYSPSTPSRFPFKTRKKGR 661 >ref|XP_015967520.1| receptor-like serine/threonine-protein kinase At4g25390 [Arachis duranensis] Length = 694 Score = 76.6 bits (187), Expect = 8e-14 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 SMKEVVGMLSG LEPPQLP+EYSPSTPSRFPFK+R+KG+ Sbjct: 656 SMKEVVGMLSGELEPPQLPIEYSPSTPSRFPFKTRKKGR 694 >ref|XP_006587372.1| PREDICTED: receptor-like serine/threonine-protein kinase At4g25390 isoform X2 [Glycine max] gb|KRH38668.1| hypothetical protein GLYMA_09G150100 [Glycine max] gb|KRH38669.1| hypothetical protein GLYMA_09G150100 [Glycine max] Length = 730 Score = 76.6 bits (187), Expect = 8e-14 Identities = 37/42 (88%), Positives = 37/42 (88%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK*VG 231 SMKEVVGMLSG LEPPQLPVEYSPSTPSRFPFKS RKG G Sbjct: 647 SMKEVVGMLSGELEPPQLPVEYSPSTPSRFPFKSSRKGSLYG 688 >gb|KRH38666.1| hypothetical protein GLYMA_09G150100 [Glycine max] Length = 753 Score = 76.3 bits (186), Expect = 1e-13 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKG 243 SMKEVVGMLSG LEPPQLPVEYSPSTPSRFPFKS RKG Sbjct: 647 SMKEVVGMLSGELEPPQLPVEYSPSTPSRFPFKSSRKG 684 >ref|XP_014617669.1| PREDICTED: receptor-like serine/threonine-protein kinase At4g25390 isoform X1 [Glycine max] gb|KRH38667.1| hypothetical protein GLYMA_09G150100 [Glycine max] Length = 782 Score = 76.3 bits (186), Expect = 1e-13 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKG 243 SMKEVVGMLSG LEPPQLPVEYSPSTPSRFPFKS RKG Sbjct: 647 SMKEVVGMLSGELEPPQLPVEYSPSTPSRFPFKSSRKG 684 >dbj|BAU02432.1| hypothetical protein VIGAN_11196000 [Vigna angularis var. angularis] Length = 659 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 S+KEVVGMLSG LEPPQLPVEYSPSTPSR+PFKSRRKG+ Sbjct: 621 SLKEVVGMLSGVLEPPQLPVEYSPSTPSRYPFKSRRKGR 659 >ref|XP_017438575.1| PREDICTED: receptor-like serine/threonine-protein kinase At4g25390 [Vigna angularis] gb|KOM54912.1| hypothetical protein LR48_Vigan10g080400 [Vigna angularis] Length = 659 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 S+KEVVGMLSG LEPPQLPVEYSPSTPSR+PFKSRRKG+ Sbjct: 621 SLKEVVGMLSGVLEPPQLPVEYSPSTPSRYPFKSRRKGR 659 >ref|XP_004506300.1| PREDICTED: receptor-like serine/threonine-protein kinase At4g25390 [Cicer arietinum] Length = 681 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 SMKEVVGMLSG LEPPQLPVEYSPSTPSRFPFKSR+K + Sbjct: 643 SMKEVVGMLSGELEPPQLPVEYSPSTPSRFPFKSRKKAR 681 >ref|XP_019465045.1| PREDICTED: receptor-like serine/threonine-protein kinase At4g25390 [Lupinus angustifolius] gb|OIV98934.1| hypothetical protein TanjilG_07369 [Lupinus angustifolius] Length = 632 Score = 75.1 bits (183), Expect = 3e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 SMKEV+GMLSG LEPPQ+PVEYSPSTPSRFPFKSR KG+ Sbjct: 594 SMKEVLGMLSGELEPPQVPVEYSPSTPSRFPFKSRNKGR 632 >dbj|GAU28890.1| hypothetical protein TSUD_293420 [Trifolium subterraneum] Length = 576 Score = 74.7 bits (182), Expect = 4e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 356 SMKEVVGMLSGNLEPPQLPVEYSPSTPSRFPFKSRRKGK 240 SMKEVVGMLSG LE PQLPVEYSPSTPSRFPFKSR+KG+ Sbjct: 533 SMKEVVGMLSGELETPQLPVEYSPSTPSRFPFKSRKKGQ 571