BLASTX nr result
ID: Astragalus23_contig00031721
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00031721 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020202111.1| uncharacterized protein LOC109787924 [Cajanu... 58 4e-07 gb|OMP00304.1| putative Zinc finger, BED-type [Corchorus capsula... 57 2e-06 gb|KYP57411.1| hypothetical protein KK1_003673 [Cajanus cajan] 54 2e-06 >ref|XP_020202111.1| uncharacterized protein LOC109787924 [Cajanus cajan] Length = 309 Score = 58.2 bits (139), Expect = 4e-07 Identities = 31/37 (83%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = -3 Query: 109 AKKFVDLVLDSGFWKKCAIIVKLSE-LVRVLRIVDSE 2 AKKFV+ VLDSGFW KCA IVKL+E LVRVLRIVDSE Sbjct: 18 AKKFVEQVLDSGFWTKCADIVKLTEPLVRVLRIVDSE 54 >gb|OMP00304.1| putative Zinc finger, BED-type [Corchorus capsularis] Length = 609 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/36 (80%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -3 Query: 106 KKFVDLVLDSGFWKKCAIIVKLSE-LVRVLRIVDSE 2 +KFVDLVLDS FWK+CA IVK++E LVRVLRIVDSE Sbjct: 323 RKFVDLVLDSTFWKQCATIVKVTEPLVRVLRIVDSE 358 >gb|KYP57411.1| hypothetical protein KK1_003673 [Cajanus cajan] Length = 114 Score = 53.5 bits (127), Expect = 2e-06 Identities = 28/37 (75%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = -3 Query: 109 AKKFVDLVLDSGFWKKCAIIVKLSE-LVRVLRIVDSE 2 AKKFV+ VLDSGFW KC IVKL+E VRVLRIVD E Sbjct: 55 AKKFVEQVLDSGFWTKCVDIVKLTEPFVRVLRIVDKE 91