BLASTX nr result
ID: Astragalus23_contig00031614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00031614 (340 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013446762.1| pentatricopeptide (PPR) repeat protein [Medi... 80 4e-15 ref|XP_004504106.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-14 gb|KHN16630.1| Pentatricopeptide repeat-containing protein [Glyc... 72 3e-12 gb|KRH41515.1| hypothetical protein GLYMA_08G034900 [Glycine max] 72 4e-12 ref|XP_007146673.1| hypothetical protein PHAVU_006G0599001g, par... 64 4e-11 gb|PNX96543.1| pentatricopeptide repeat-containing protein at4g0... 68 8e-11 ref|XP_020205336.1| pentatricopeptide repeat-containing protein ... 66 4e-10 ref|XP_007146519.1| hypothetical protein PHAVU_006G0477000g, par... 63 7e-10 dbj|GAU19136.1| hypothetical protein TSUD_79590 [Trifolium subte... 65 7e-10 ref|XP_006584019.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-09 gb|KHN02948.1| Pentatricopeptide repeat-containing protein [Glyc... 63 4e-09 ref|XP_022642468.1| pentatricopeptide repeat-containing protein ... 62 1e-08 ref|XP_017409314.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-08 ref|XP_017409312.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-08 ref|XP_019420279.1| PREDICTED: pentatricopeptide repeat-containi... 54 6e-06 >ref|XP_013446762.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|KEH20789.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 701 Score = 80.1 bits (196), Expect = 4e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -1 Query: 136 AKLIKPMMKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 AKL+KP MK+KQ+LREAIDLLF RGPAS +DYTRLVLHCAQ+NDF Sbjct: 2 AKLVKPTMKLKQQLREAIDLLFTRGPASSSDYTRLVLHCAQSNDF 46 >ref|XP_004504106.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cicer arietinum] ref|XP_004504107.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cicer arietinum] ref|XP_012572223.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cicer arietinum] Length = 699 Score = 77.4 bits (189), Expect = 3e-14 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -1 Query: 130 LIKPMMKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 LIK MKVKQ+LREAIDLLF RGPAS ADYTRLVLHCAQANDF Sbjct: 2 LIKTTMKVKQQLREAIDLLFTRGPASSADYTRLVLHCAQANDF 44 >gb|KHN16630.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 369 Score = 71.6 bits (174), Expect = 3e-12 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -1 Query: 139 KAKLIKPMMKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 +A+L KP +KVKQ+L +AIDLL++ GPASF DYTR VLHCA+ANDF Sbjct: 15 EAELTKPKVKVKQKLHQAIDLLYSHGPASFDDYTRFVLHCARANDF 60 >gb|KRH41515.1| hypothetical protein GLYMA_08G034900 [Glycine max] Length = 524 Score = 71.6 bits (174), Expect = 4e-12 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -1 Query: 139 KAKLIKPMMKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 +A+L KP +KVKQ+L +AIDLL++ GPASF DYTR VLHCA+ANDF Sbjct: 15 EAELTKPKVKVKQKLHQAIDLLYSHGPASFDDYTRFVLHCARANDF 60 >ref|XP_007146673.1| hypothetical protein PHAVU_006G0599001g, partial [Phaseolus vulgaris] gb|ESW18667.1| hypothetical protein PHAVU_006G0599001g, partial [Phaseolus vulgaris] Length = 79 Score = 63.9 bits (154), Expect = 4e-11 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MKVKQ+L +AIDLL++ GP SF DYTRLVLHC +ANDF Sbjct: 1 MKVKQKLHQAIDLLYSNGPTSFDDYTRLVLHCVRANDF 38 >gb|PNX96543.1| pentatricopeptide repeat-containing protein at4g02750-like protein [Trifolium pratense] Length = 693 Score = 67.8 bits (164), Expect = 8e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MK+KQ+LREAID LF RGPAS ADYTRLVLHCA++NDF Sbjct: 1 MKLKQQLREAIDFLFTRGPASSADYTRLVLHCARSNDF 38 >ref|XP_020205336.1| pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cajanus cajan] ref|XP_020205337.1| pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cajanus cajan] ref|XP_020220844.1| pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cajanus cajan] ref|XP_020220845.1| pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cajanus cajan] ref|XP_020220846.1| pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cajanus cajan] ref|XP_020220847.1| pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cajanus cajan] ref|XP_020220848.1| pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cajanus cajan] Length = 693 Score = 65.9 bits (159), Expect = 4e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MKVKQ+L +A+DLL++ GPASF DYTRLVLHCA+ANDF Sbjct: 1 MKVKQKLHQAMDLLYSHGPASFDDYTRLVLHCARANDF 38 >ref|XP_007146519.1| hypothetical protein PHAVU_006G0477000g, partial [Phaseolus vulgaris] gb|ESW18513.1| hypothetical protein PHAVU_006G0477000g, partial [Phaseolus vulgaris] Length = 184 Score = 63.2 bits (152), Expect = 7e-10 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MKVKQ+ +AIDLL++ GP SF DYTRLVLHC +ANDF Sbjct: 1 MKVKQKFHQAIDLLYSNGPTSFGDYTRLVLHCVRANDF 38 >dbj|GAU19136.1| hypothetical protein TSUD_79590 [Trifolium subterraneum] Length = 747 Score = 65.1 bits (157), Expect = 7e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MK+KQ+LREAID LF RGP S ADYTR VLHCAQ+NDF Sbjct: 1 MKLKQQLREAIDFLFTRGPVSSADYTRHVLHCAQSNDF 38 >ref|XP_006584019.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Glycine max] ref|XP_014633706.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Glycine max] ref|XP_014633707.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Glycine max] ref|XP_014633708.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Glycine max] gb|KRH50811.1| hypothetical protein GLYMA_07G245500 [Glycine max] Length = 693 Score = 63.2 bits (152), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MKVKQ+L +AIDLL++ G ASF DYTRLVLHCA+ANDF Sbjct: 1 MKVKQKLHQAIDLLYSHGLASFDDYTRLVLHCARANDF 38 >gb|KHN02948.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 841 Score = 63.2 bits (152), Expect = 4e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MKVKQ+L +AIDLL++ G ASF DYTRLVLHCA+ANDF Sbjct: 1 MKVKQKLHQAIDLLYSHGLASFDDYTRLVLHCARANDF 38 >ref|XP_022642468.1| pentatricopeptide repeat-containing protein At5g04780, mitochondrial-like [Vigna radiata var. radiata] ref|XP_022642469.1| pentatricopeptide repeat-containing protein At5g04780, mitochondrial-like [Vigna radiata var. radiata] ref|XP_022642470.1| pentatricopeptide repeat-containing protein At5g04780, mitochondrial-like [Vigna radiata var. radiata] Length = 694 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MKVKQ L +AIDLL++ GP S DYTRLVLHCA+ANDF Sbjct: 1 MKVKQMLHQAIDLLYSNGPTSVDDYTRLVLHCARANDF 38 >ref|XP_017409314.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like isoform X2 [Vigna angularis] Length = 730 Score = 60.1 bits (144), Expect = 4e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MKVKQ L + IDLL++ GP S DYTRLVLHCA+ANDF Sbjct: 38 MKVKQMLHQTIDLLYSNGPTSVNDYTRLVLHCARANDF 75 >ref|XP_017409312.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like isoform X1 [Vigna angularis] ref|XP_017409313.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like isoform X1 [Vigna angularis] Length = 736 Score = 60.1 bits (144), Expect = 4e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MKVKQ L + IDLL++ GP S DYTRLVLHCA+ANDF Sbjct: 44 MKVKQMLHQTIDLLYSNGPTSVNDYTRLVLHCARANDF 81 >ref|XP_019420279.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Lupinus angustifolius] ref|XP_019420280.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Lupinus angustifolius] gb|OIV94289.1| hypothetical protein TanjilG_00038 [Lupinus angustifolius] Length = 694 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -1 Query: 115 MKVKQRLREAIDLLFARGPASFADYTRLVLHCAQANDF 2 MKVKQ L AID + +R PA+ DYTRLVLHC +ANDF Sbjct: 1 MKVKQNLHRAIDFMRSREPATSNDYTRLVLHCVRANDF 38