BLASTX nr result
ID: Astragalus23_contig00031102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00031102 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU49473.1| hypothetical protein TSUD_91450 [Trifolium subte... 73 1e-12 gb|KRH29234.1| hypothetical protein GLYMA_11G104300 [Glycine max] 70 2e-11 ref|XP_003537793.1| PREDICTED: BTB/POZ domain-containing protein... 70 2e-11 ref|XP_013456518.1| phototropic-responsive NPH3 family protein [... 69 3e-11 ref|XP_013456516.1| phototropic-responsive NPH3 family protein [... 69 3e-11 ref|XP_020215215.1| BTB/POZ domain-containing protein At1g50280-... 68 8e-11 gb|KRH24226.1| hypothetical protein GLYMA_12G029300 [Glycine max] 68 1e-10 ref|XP_017433690.1| PREDICTED: BTB/POZ domain-containing protein... 68 1e-10 ref|XP_014520109.1| BTB/POZ domain-containing protein At1g50280 ... 68 1e-10 gb|KHN05424.1| BTB/POZ domain-containing protein [Glycine soja] 68 1e-10 ref|XP_014619937.1| PREDICTED: BTB/POZ domain-containing protein... 68 1e-10 gb|PNY15917.1| BTB/POZ domain-containing protein [Trifolium prat... 67 2e-10 ref|XP_007131678.1| hypothetical protein PHAVU_011G032500g [Phas... 64 3e-09 ref|XP_004505756.1| PREDICTED: BTB/POZ domain-containing protein... 63 6e-09 ref|XP_016186809.1| BTB/POZ domain-containing protein At1g50280 ... 63 6e-09 ref|XP_015952617.1| BTB/POZ domain-containing protein At1g50280 ... 63 6e-09 gb|PIN26215.1| hypothetical protein CDL12_01030 [Handroanthus im... 58 3e-07 ref|XP_019450555.1| PREDICTED: BTB/POZ domain-containing protein... 57 9e-07 gb|OIW08843.1| hypothetical protein TanjilG_16424 [Lupinus angus... 57 9e-07 gb|AMK48012.1| putative BTB POZ domain protein [Lupinus angustif... 56 2e-06 >dbj|GAU49473.1| hypothetical protein TSUD_91450 [Trifolium subterraneum] Length = 547 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M KPCDLQININGQQ FLLKEKIISKYCG VKK ++NHQKR Sbjct: 1 MTKPCDLQININGQQIFLLKEKIISKYCGKVKK-ILNHQKR 40 >gb|KRH29234.1| hypothetical protein GLYMA_11G104300 [Glycine max] Length = 411 Score = 69.7 bits (169), Expect = 2e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M KPCDLQINI+GQQ FLLKEK+ISKYCG +KKL +NHQKR Sbjct: 1 MPKPCDLQINIDGQQIFLLKEKVISKYCGGLKKL-LNHQKR 40 >ref|XP_003537793.1| PREDICTED: BTB/POZ domain-containing protein At1g50280-like [Glycine max] ref|XP_006590828.1| PREDICTED: BTB/POZ domain-containing protein At1g50280-like [Glycine max] ref|XP_006590829.1| PREDICTED: BTB/POZ domain-containing protein At1g50280-like [Glycine max] gb|KHN39904.1| BTB/POZ domain-containing protein [Glycine soja] gb|KRH29231.1| hypothetical protein GLYMA_11G104300 [Glycine max] gb|KRH29232.1| hypothetical protein GLYMA_11G104300 [Glycine max] gb|KRH29233.1| hypothetical protein GLYMA_11G104300 [Glycine max] Length = 541 Score = 69.7 bits (169), Expect = 2e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M KPCDLQINI+GQQ FLLKEK+ISKYCG +KKL +NHQKR Sbjct: 1 MPKPCDLQINIDGQQIFLLKEKVISKYCGGLKKL-LNHQKR 40 >ref|XP_013456518.1| phototropic-responsive NPH3 family protein [Medicago truncatula] gb|KEH30549.1| phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 443 Score = 69.3 bits (168), Expect = 3e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 MAK CDLQI INGQQ FLLKEKIISKYCG VKK ++NHQKR Sbjct: 1 MAKSCDLQIKINGQQIFLLKEKIISKYCGKVKK-ILNHQKR 40 >ref|XP_013456516.1| phototropic-responsive NPH3 family protein [Medicago truncatula] gb|KEH30547.1| phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 548 Score = 69.3 bits (168), Expect = 3e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 MAK CDLQI INGQQ FLLKEKIISKYCG VKK ++NHQKR Sbjct: 1 MAKSCDLQIKINGQQIFLLKEKIISKYCGKVKK-ILNHQKR 40 >ref|XP_020215215.1| BTB/POZ domain-containing protein At1g50280-like [Cajanus cajan] gb|KYP68363.1| BTB/POZ domain-containing protein At1g30440 family [Cajanus cajan] Length = 540 Score = 68.2 bits (165), Expect = 8e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M KPCDLQINI+GQQ F LKEK+ISKYCG +KK V+NHQKR Sbjct: 1 MPKPCDLQINIDGQQIFFLKEKVISKYCGGLKK-VLNHQKR 40 >gb|KRH24226.1| hypothetical protein GLYMA_12G029300 [Glycine max] Length = 434 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M KPCDL+INI+GQQ FLLKEK+ISKYCG +KK ++NHQKR Sbjct: 1 MPKPCDLKINIDGQQIFLLKEKVISKYCGGLKK-ILNHQKR 40 >ref|XP_017433690.1| PREDICTED: BTB/POZ domain-containing protein At1g50280-like [Vigna angularis] ref|XP_017433692.1| PREDICTED: BTB/POZ domain-containing protein At1g50280-like [Vigna angularis] ref|XP_017433693.1| PREDICTED: BTB/POZ domain-containing protein At1g50280-like [Vigna angularis] gb|KOM51030.1| hypothetical protein LR48_Vigan08g185700 [Vigna angularis] dbj|BAT91070.1| hypothetical protein VIGAN_06237600 [Vigna angularis var. angularis] Length = 540 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M KPCDLQINI+GQQ FLLKEK+ISKYCG +KK ++NH+KR Sbjct: 1 MPKPCDLQINIDGQQIFLLKEKVISKYCGGLKK-ILNHRKR 40 >ref|XP_014520109.1| BTB/POZ domain-containing protein At1g50280 [Vigna radiata var. radiata] ref|XP_014520118.1| BTB/POZ domain-containing protein At1g50280 [Vigna radiata var. radiata] ref|XP_014520126.1| BTB/POZ domain-containing protein At1g50280 [Vigna radiata var. radiata] Length = 542 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M KPCDLQINI+GQQ FLLKEK+ISKYCG +KK ++NH+KR Sbjct: 1 MPKPCDLQINIDGQQIFLLKEKVISKYCGGLKK-ILNHRKR 40 >gb|KHN05424.1| BTB/POZ domain-containing protein [Glycine soja] Length = 542 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M KPCDL+INI+GQQ FLLKEK+ISKYCG +KK ++NHQKR Sbjct: 1 MPKPCDLKINIDGQQIFLLKEKVISKYCGGLKK-ILNHQKR 40 >ref|XP_014619937.1| PREDICTED: BTB/POZ domain-containing protein At1g50280-like [Glycine max] gb|KRH24225.1| hypothetical protein GLYMA_12G029300 [Glycine max] Length = 542 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M KPCDL+INI+GQQ FLLKEK+ISKYCG +KK ++NHQKR Sbjct: 1 MPKPCDLKINIDGQQIFLLKEKVISKYCGGLKK-ILNHQKR 40 >gb|PNY15917.1| BTB/POZ domain-containing protein [Trifolium pratense] Length = 546 Score = 67.0 bits (162), Expect = 2e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M KPCDLQI IN QQ FLLKEKIISKYCG VKK ++NHQK+ Sbjct: 1 MTKPCDLQIKINDQQIFLLKEKIISKYCGEVKK-ILNHQKK 40 >ref|XP_007131678.1| hypothetical protein PHAVU_011G032500g [Phaseolus vulgaris] gb|ESW03672.1| hypothetical protein PHAVU_011G032500g [Phaseolus vulgaris] Length = 538 Score = 63.5 bits (153), Expect = 3e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M K CDLQINI+GQQ FLLKEK+ISKYCG +KK++ N ++R Sbjct: 1 MPKACDLQINIDGQQIFLLKEKVISKYCGGLKKILNNRKRR 41 >ref|XP_004505756.1| PREDICTED: BTB/POZ domain-containing protein At1g50280-like [Cicer arietinum] Length = 548 Score = 62.8 bits (151), Expect = 6e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M PCDLQI IN QQ FLLKEKI+SKYCG VKK ++N QKR Sbjct: 1 MVNPCDLQIKINDQQIFLLKEKIVSKYCGKVKK-ILNQQKR 40 >ref|XP_016186809.1| BTB/POZ domain-containing protein At1g50280 isoform X1 [Arachis ipaensis] Length = 551 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M K CD+QINI+GQQ FLLKEK++SKYCG +K+ ++NHQKR Sbjct: 1 MPKHCDMQINIDGQQIFLLKEKVMSKYCGKLKR-ILNHQKR 40 >ref|XP_015952617.1| BTB/POZ domain-containing protein At1g50280 isoform X1 [Arachis duranensis] Length = 551 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M K CD+QINI+GQQ FLLKEK++SKYCG +K+ ++NHQKR Sbjct: 1 MPKHCDMQINIDGQQIFLLKEKVMSKYCGKLKR-ILNHQKR 40 >gb|PIN26215.1| hypothetical protein CDL12_01030 [Handroanthus impetiginosus] Length = 555 Score = 57.8 bits (138), Expect = 3e-07 Identities = 23/47 (48%), Positives = 37/47 (78%) Frame = -2 Query: 142 LNSEVAMAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 + S+ M++PCDLQI+INGQQ F+L E+I+SKY G ++K++ ++R Sbjct: 1 MQSKPTMSEPCDLQIHINGQQTFVLSERILSKYSGKLRKIIKQEKRR 47 >ref|XP_019450555.1| PREDICTED: BTB/POZ domain-containing protein At3g19850-like [Lupinus angustifolius] Length = 523 Score = 56.6 bits (135), Expect = 9e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M K C+LQIN+NGQ FL+ EKIIS+YCG VKK ++NH++R Sbjct: 1 MPKLCNLQINMNGQHIFLVNEKIISRYCGRVKK-ILNHEER 40 >gb|OIW08843.1| hypothetical protein TanjilG_16424 [Lupinus angustifolius] Length = 730 Score = 56.6 bits (135), Expect = 9e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M K C+LQIN+NGQ FL+ EKIIS+YCG VKK ++NH++R Sbjct: 1 MPKLCNLQINMNGQHIFLVNEKIISRYCGRVKK-ILNHEER 40 >gb|AMK48012.1| putative BTB POZ domain protein [Lupinus angustifolius] Length = 443 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 124 MAKPCDLQININGQQRFLLKEKIISKYCGSVKKLVMNHQKR 2 M K CDL+ININ Q FL+ +KIISKYCG VKK ++ H+KR Sbjct: 1 MQKSCDLKININDHQLFLVNQKIISKYCGRVKK-ILKHEKR 40