BLASTX nr result
ID: Astragalus23_contig00031020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00031020 (331 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600917.1| double Clp-N motif P-loop nucleoside triphos... 55 2e-06 gb|KHN04768.1| Chaperone protein ClpC2, chloroplastic, partial [... 54 8e-06 ref|XP_006591384.1| PREDICTED: uncharacterized protein LOC100800... 54 8e-06 >ref|XP_003600917.1| double Clp-N motif P-loop nucleoside triphosphate hydrolase superfamily protein [Medicago truncatula] gb|AES71168.1| double Clp-N motif P-loop nucleoside triphosphate hydrolase superfamily protein [Medicago truncatula] Length = 1081 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 1 RRYKLTASSIVKLVTCPEQAPIAHLPQRIILD 96 RRY LTASSIVKLVTCPEQA HLP RI+LD Sbjct: 1050 RRYNLTASSIVKLVTCPEQASSVHLPPRIVLD 1081 >gb|KHN04768.1| Chaperone protein ClpC2, chloroplastic, partial [Glycine soja] Length = 820 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 1 RRYKLTASSIVKLVTCPEQAPIAHLPQRIILD 96 RRY LTASSIVKL TCPEQA HLP RIILD Sbjct: 789 RRYNLTASSIVKLATCPEQAAGVHLPSRIILD 820 >ref|XP_006591384.1| PREDICTED: uncharacterized protein LOC100800606 [Glycine max] gb|KRH31154.1| hypothetical protein GLYMA_11G230700 [Glycine max] Length = 1083 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 1 RRYKLTASSIVKLVTCPEQAPIAHLPQRIILD 96 RRY LTASSIVKL TCPEQA HLP RIILD Sbjct: 1052 RRYNLTASSIVKLATCPEQAAGVHLPSRIILD 1083