BLASTX nr result
ID: Astragalus23_contig00025773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00025773 (621 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU30058.1| hypothetical protein TSUD_332270 [Trifolium subt... 178 2e-48 ref|XP_013449601.1| PPR containing plant-like protein [Medicago ... 178 4e-48 ref|XP_012569314.1| PREDICTED: pentatricopeptide repeat-containi... 171 1e-45 ref|XP_012569304.1| PREDICTED: pentatricopeptide repeat-containi... 171 2e-45 gb|PNY06954.1| pentatricopeptide repeat-containing protein [Trif... 168 1e-44 ref|XP_003528536.1| PREDICTED: pentatricopeptide repeat-containi... 158 5e-41 gb|KHN43025.1| Pentatricopeptide repeat-containing protein [Glyc... 156 1e-40 gb|OIW10212.1| hypothetical protein TanjilG_27963 [Lupinus angus... 153 2e-39 ref|XP_019445838.1| PREDICTED: pentatricopeptide repeat-containi... 153 3e-39 gb|KYP40874.1| Pentatricopeptide repeat-containing protein At5g5... 149 4e-38 ref|XP_020201834.1| pentatricopeptide repeat-containing protein ... 149 6e-38 ref|XP_016184045.1| pentatricopeptide repeat-containing protein ... 147 2e-37 gb|OIV93310.1| hypothetical protein TanjilG_14561 [Lupinus angus... 147 3e-37 ref|XP_019424577.1| PREDICTED: pentatricopeptide repeat-containi... 147 3e-37 ref|XP_019424576.1| PREDICTED: pentatricopeptide repeat-containi... 147 3e-37 ref|XP_015950539.2| pentatricopeptide repeat-containing protein ... 144 3e-36 ref|XP_017437162.1| PREDICTED: pentatricopeptide repeat-containi... 132 4e-32 ref|XP_017437158.1| PREDICTED: pentatricopeptide repeat-containi... 132 4e-32 ref|XP_018854889.1| PREDICTED: pentatricopeptide repeat-containi... 120 1e-27 ref|XP_006464385.1| PREDICTED: pentatricopeptide repeat-containi... 117 9e-27 >dbj|GAU30058.1| hypothetical protein TSUD_332270 [Trifolium subterraneum] Length = 774 Score = 178 bits (452), Expect = 2e-48 Identities = 85/94 (90%), Positives = 90/94 (95%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHFCKQGMPERALLWGQKLRDICF FDEIS+IILD+A+NLVQNEVELVRGTYEKSLFLD Sbjct: 681 LSHFCKQGMPERALLWGQKLRDICFDFDEISHIILDRANNLVQNEVELVRGTYEKSLFLD 740 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLMYITFDHF+RNRP NIENEN LKLIESQ+ AL Sbjct: 741 FLMYITFDHFSRNRPHNIENENGLKLIESQYVAL 774 >ref|XP_013449601.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH23629.1| PPR containing plant-like protein [Medicago truncatula] Length = 911 Score = 178 bits (451), Expect = 4e-48 Identities = 85/94 (90%), Positives = 91/94 (96%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHFCKQGMPERALLWGQKLRDICF FDEISYIILD+A++LVQNEVELVRGTYEKSLFLD Sbjct: 818 LSHFCKQGMPERALLWGQKLRDICFDFDEISYIILDRANHLVQNEVELVRGTYEKSLFLD 877 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLMYITFDHF+RNRPR+IENEN LKLIESQ+ AL Sbjct: 878 FLMYITFDHFSRNRPRSIENENCLKLIESQYVAL 911 >ref|XP_012569314.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X2 [Cicer arietinum] Length = 832 Score = 171 bits (432), Expect = 1e-45 Identities = 80/94 (85%), Positives = 89/94 (94%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHFCKQGMPERALLWG+KLR+ICFGFDEISYIILD+A++LVQNE ELVRGTYEKSLFLD Sbjct: 739 LSHFCKQGMPERALLWGEKLREICFGFDEISYIILDRANHLVQNEAELVRGTYEKSLFLD 798 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLMYITFDHF+RNRP IEN+NS KLIES++ AL Sbjct: 799 FLMYITFDHFSRNRPHIIENDNSFKLIESRYVAL 832 >ref|XP_012569304.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Cicer arietinum] ref|XP_012569305.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Cicer arietinum] ref|XP_012569306.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Cicer arietinum] ref|XP_012569307.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Cicer arietinum] ref|XP_012569308.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Cicer arietinum] ref|XP_012569309.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Cicer arietinum] ref|XP_012569310.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Cicer arietinum] ref|XP_012569311.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Cicer arietinum] ref|XP_012569312.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Cicer arietinum] ref|XP_012569313.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Cicer arietinum] Length = 864 Score = 171 bits (432), Expect = 2e-45 Identities = 80/94 (85%), Positives = 89/94 (94%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHFCKQGMPERALLWG+KLR+ICFGFDEISYIILD+A++LVQNE ELVRGTYEKSLFLD Sbjct: 771 LSHFCKQGMPERALLWGEKLREICFGFDEISYIILDRANHLVQNEAELVRGTYEKSLFLD 830 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLMYITFDHF+RNRP IEN+NS KLIES++ AL Sbjct: 831 FLMYITFDHFSRNRPHIIENDNSFKLIESRYVAL 864 >gb|PNY06954.1| pentatricopeptide repeat-containing protein [Trifolium pratense] Length = 774 Score = 168 bits (425), Expect = 1e-44 Identities = 83/97 (85%), Positives = 89/97 (91%), Gaps = 3/97 (3%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELV---RGTYEKSL 172 LSHFCKQGMPERALLWGQKLRDICF FDEIS IILD+A++L+QNEVELV RGTYEKSL Sbjct: 678 LSHFCKQGMPERALLWGQKLRDICFDFDEISDIILDRANHLMQNEVELVRGMRGTYEKSL 737 Query: 173 FLDFLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLDFLMYITFDHF+RNRP NIENEN LKLIESQ+ AL Sbjct: 738 FLDFLMYITFDHFSRNRPHNIENENGLKLIESQYVAL 774 >ref|XP_003528536.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Glycine max] ref|XP_006583900.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Glycine max] ref|XP_006583901.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Glycine max] ref|XP_006583903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Glycine max] ref|XP_014633657.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Glycine max] gb|KRH50373.1| hypothetical protein GLYMA_07G218100 [Glycine max] Length = 871 Score = 158 bits (399), Expect = 5e-41 Identities = 73/94 (77%), Positives = 88/94 (93%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHFCKQGMPE+AL+WGQKLR+I FGFDEISY ILD+A+ L+Q++VELVRGTYEK LF+D Sbjct: 778 LSHFCKQGMPEKALIWGQKLREISFGFDEISYRILDQAYCLMQDDVELVRGTYEKHLFMD 837 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLMYITFD+F+RN+P+ IENENS+KLIE+QF AL Sbjct: 838 FLMYITFDYFSRNKPQKIENENSIKLIENQFVAL 871 >gb|KHN43025.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 775 Score = 156 bits (395), Expect = 1e-40 Identities = 72/94 (76%), Positives = 88/94 (93%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHFCK+GMPE+AL+WGQKLR+I FGFDEISY ILD+A+ L+Q++VELVRGTYEK LF+D Sbjct: 682 LSHFCKRGMPEKALIWGQKLREISFGFDEISYRILDQAYCLMQDDVELVRGTYEKHLFMD 741 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLMYITFD+F+RN+P+ IENENS+KLIE+QF AL Sbjct: 742 FLMYITFDYFSRNKPQKIENENSIKLIENQFVAL 775 >gb|OIW10212.1| hypothetical protein TanjilG_27963 [Lupinus angustifolius] Length = 777 Score = 153 bits (386), Expect = 2e-39 Identities = 72/96 (75%), Positives = 87/96 (90%), Gaps = 2/96 (2%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVEL--VRGTYEKSLF 175 LSHFCKQGMPE+ALLWGQKLR+IC+GFDEISY ILD+A++L+Q ++EL VR TYEKS+F Sbjct: 682 LSHFCKQGMPEKALLWGQKLREICYGFDEISYRILDQAYHLMQTDIELVTVRATYEKSIF 741 Query: 176 LDFLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 LDFLMYITFD+ +RN+P IEN+NSLKLIES+F AL Sbjct: 742 LDFLMYITFDYVSRNKPHKIENDNSLKLIESRFVAL 777 >ref|XP_019445838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Lupinus angustifolius] Length = 888 Score = 153 bits (386), Expect = 3e-39 Identities = 72/96 (75%), Positives = 87/96 (90%), Gaps = 2/96 (2%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVEL--VRGTYEKSLF 175 LSHFCKQGMPE+ALLWGQKLR+IC+GFDEISY ILD+A++L+Q ++EL VR TYEKS+F Sbjct: 793 LSHFCKQGMPEKALLWGQKLREICYGFDEISYRILDQAYHLMQTDIELVTVRATYEKSIF 852 Query: 176 LDFLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 LDFLMYITFD+ +RN+P IEN+NSLKLIES+F AL Sbjct: 853 LDFLMYITFDYVSRNKPHKIENDNSLKLIESRFVAL 888 >gb|KYP40874.1| Pentatricopeptide repeat-containing protein At5g55840 family [Cajanus cajan] Length = 708 Score = 149 bits (376), Expect = 4e-38 Identities = 72/96 (75%), Positives = 85/96 (88%), Gaps = 2/96 (2%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHFCKQGMPE+ALLWGQKLR+I +G DEISY ILD+A+ L Q++VELVRGTYEK LF+D Sbjct: 613 LSHFCKQGMPEKALLWGQKLREISYGLDEISYRILDQAYRLTQDDVELVRGTYEKGLFMD 672 Query: 182 FLMYITFDHFARNRPRNIENENS--LKLIESQFAAL 283 FLMYITFD+F+RN+ + IENENS +KLIESQF AL Sbjct: 673 FLMYITFDYFSRNKSQKIENENSDNVKLIESQFVAL 708 >ref|XP_020201834.1| pentatricopeptide repeat-containing protein At1g63330-like [Cajanus cajan] ref|XP_020201835.1| pentatricopeptide repeat-containing protein At1g63330-like [Cajanus cajan] ref|XP_020201836.1| pentatricopeptide repeat-containing protein At1g63330-like [Cajanus cajan] Length = 857 Score = 149 bits (376), Expect = 6e-38 Identities = 72/96 (75%), Positives = 85/96 (88%), Gaps = 2/96 (2%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHFCKQGMPE+ALLWGQKLR+I +G DEISY ILD+A+ L Q++VELVRGTYEK LF+D Sbjct: 762 LSHFCKQGMPEKALLWGQKLREISYGLDEISYRILDQAYRLTQDDVELVRGTYEKGLFMD 821 Query: 182 FLMYITFDHFARNRPRNIENENS--LKLIESQFAAL 283 FLMYITFD+F+RN+ + IENENS +KLIESQF AL Sbjct: 822 FLMYITFDYFSRNKSQKIENENSDNVKLIESQFVAL 857 >ref|XP_016184045.1| pentatricopeptide repeat-containing protein At1g63330-like [Arachis ipaensis] Length = 888 Score = 147 bits (372), Expect = 2e-37 Identities = 72/94 (76%), Positives = 80/94 (85%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHF KQGMPERAL WGQKLRDICF FDEISY ILDKA+ L+Q++V LVR TYEKSLFLD Sbjct: 795 LSHFVKQGMPERALHWGQKLRDICFDFDEISYRILDKAYRLIQDDVPLVRVTYEKSLFLD 854 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLM+I FD F+RNRP ENENS+K+IES F AL Sbjct: 855 FLMFIAFDSFSRNRPHRTENENSVKIIESLFPAL 888 >gb|OIV93310.1| hypothetical protein TanjilG_14561 [Lupinus angustifolius] Length = 777 Score = 147 bits (371), Expect = 3e-37 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 2/96 (2%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELV--RGTYEKSLF 175 LS CKQGMPE+ALLWGQK R+I F FDEISY ILD+A+ L Q +VELV RGTYEKSLF Sbjct: 682 LSQICKQGMPEKALLWGQKFREISFDFDEISYRILDQAYRLTQTDVELVTVRGTYEKSLF 741 Query: 176 LDFLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 LDFLMYITFD+F+RN+P IENENSL+LIESQF AL Sbjct: 742 LDFLMYITFDYFSRNKPHQIENENSLELIESQFVAL 777 >ref|XP_019424577.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like isoform X2 [Lupinus angustifolius] Length = 836 Score = 147 bits (371), Expect = 3e-37 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 2/96 (2%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELV--RGTYEKSLF 175 LS CKQGMPE+ALLWGQK R+I F FDEISY ILD+A+ L Q +VELV RGTYEKSLF Sbjct: 741 LSQICKQGMPEKALLWGQKFREISFDFDEISYRILDQAYRLTQTDVELVTVRGTYEKSLF 800 Query: 176 LDFLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 LDFLMYITFD+F+RN+P IENENSL+LIESQF AL Sbjct: 801 LDFLMYITFDYFSRNKPHQIENENSLELIESQFVAL 836 >ref|XP_019424576.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform X1 [Lupinus angustifolius] Length = 932 Score = 147 bits (371), Expect = 3e-37 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 2/96 (2%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELV--RGTYEKSLF 175 LS CKQGMPE+ALLWGQK R+I F FDEISY ILD+A+ L Q +VELV RGTYEKSLF Sbjct: 837 LSQICKQGMPEKALLWGQKFREISFDFDEISYRILDQAYRLTQTDVELVTVRGTYEKSLF 896 Query: 176 LDFLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 LDFLMYITFD+F+RN+P IENENSL+LIESQF AL Sbjct: 897 LDFLMYITFDYFSRNKPHQIENENSLELIESQFVAL 932 >ref|XP_015950539.2| pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Arachis duranensis] Length = 915 Score = 144 bits (364), Expect = 3e-36 Identities = 70/94 (74%), Positives = 79/94 (84%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHF KQGMPERAL WGQKLRDICF FDEISY I DKA+ L+Q++V LV TYEKSLFLD Sbjct: 822 LSHFVKQGMPERALHWGQKLRDICFDFDEISYRIFDKAYRLIQDDVPLVSITYEKSLFLD 881 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLM+I FD+F+RNRP ENENS+K+IES F AL Sbjct: 882 FLMFIAFDYFSRNRPHGTENENSVKIIESLFPAL 915 >ref|XP_017437162.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720-like isoform X2 [Vigna angularis] Length = 845 Score = 132 bits (333), Expect = 4e-32 Identities = 63/94 (67%), Positives = 79/94 (84%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LS FCKQGMPE+A+LWGQKL + FGFDEISY ILD+A+ L ++ +ELVR TYEK LF+D Sbjct: 754 LSQFCKQGMPEKAILWGQKLSEFSFGFDEISYRILDQAYRLKRDNIELVRETYEKGLFMD 813 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLMYITFD+F+RN+P+ IEN ++LIE+QF AL Sbjct: 814 FLMYITFDYFSRNKPQKIENR--VELIENQFIAL 845 >ref|XP_017437158.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63150-like isoform X1 [Vigna angularis] ref|XP_017437159.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63150-like isoform X1 [Vigna angularis] ref|XP_017437160.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63150-like isoform X1 [Vigna angularis] ref|XP_017437161.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63150-like isoform X1 [Vigna angularis] gb|KOM52008.1| hypothetical protein LR48_Vigan09g066700 [Vigna angularis] dbj|BAT74916.1| hypothetical protein VIGAN_01269400 [Vigna angularis var. angularis] Length = 875 Score = 132 bits (333), Expect = 4e-32 Identities = 63/94 (67%), Positives = 79/94 (84%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LS FCKQGMPE+A+LWGQKL + FGFDEISY ILD+A+ L ++ +ELVR TYEK LF+D Sbjct: 784 LSQFCKQGMPEKAILWGQKLSEFSFGFDEISYRILDQAYRLKRDNIELVRETYEKGLFMD 843 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQFAAL 283 FLMYITFD+F+RN+P+ IEN ++LIE+QF AL Sbjct: 844 FLMYITFDYFSRNKPQKIENR--VELIENQFIAL 875 >ref|XP_018854889.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12620-like [Juglans regia] Length = 888 Score = 120 bits (300), Expect = 1e-27 Identities = 57/91 (62%), Positives = 72/91 (79%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHFCKQGMPERAL+W QKL +I F FDEI++ I+D+A++ +Q + EL R T K+LFLD Sbjct: 795 LSHFCKQGMPERALMWCQKLSEISFDFDEITFRIMDRAYSNIQEDEELFRETSAKNLFLD 854 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIESQF 274 FLMYIT+D+F RNRP N+NSLKLI + F Sbjct: 855 FLMYITYDYFYRNRPHRDTNQNSLKLIGNGF 885 >ref|XP_006464385.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Citrus sinensis] ref|XP_006464386.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Citrus sinensis] ref|XP_015383507.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Citrus sinensis] Length = 880 Score = 117 bits (293), Expect = 9e-27 Identities = 56/88 (63%), Positives = 68/88 (77%) Frame = +2 Query: 2 LSHFCKQGMPERALLWGQKLRDICFGFDEISYIILDKAHNLVQNEVELVRGTYEKSLFLD 181 LSHFCKQGMPE+ LLWGQKL +I F FDE SY I+D+A++ +Q E + T EKSLFLD Sbjct: 787 LSHFCKQGMPEKTLLWGQKLSEISFDFDETSYKIMDRAYHNIQENAEFFQETSEKSLFLD 846 Query: 182 FLMYITFDHFARNRPRNIENENSLKLIE 265 FLMYIT+D+F RNRP ++ SLKLIE Sbjct: 847 FLMYITYDYFWRNRPNYKTSQASLKLIE 874