BLASTX nr result
ID: Astragalus23_contig00025562
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00025562 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240636.1| beta-glucosidase 18-like [Cajanus cajan] 68 2e-10 >ref|XP_020240636.1| beta-glucosidase 18-like [Cajanus cajan] Length = 571 Score = 68.2 bits (165), Expect = 2e-10 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 21 GHSQLHYLNGMAAVFLVPIPAHSRRSPSRNI*SLGYELAFDSV 149 G ++ NGMAAVFLVPIPAHSR SPSRNI SLGYELAFDSV Sbjct: 18 GDCGTYFRNGMAAVFLVPIPAHSRTSPSRNIESLGYELAFDSV 60