BLASTX nr result
ID: Astragalus23_contig00024445
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00024445 (296 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007154779.1| hypothetical protein PHAVU_003G147200g [Phas... 69 2e-12 ref|XP_014620633.1| PREDICTED: CASP-like protein 2C1 isoform X1 ... 68 3e-12 ref|XP_017409617.1| PREDICTED: CASP-like protein 2C1 [Vigna angu... 68 5e-12 gb|KHN22710.1| CASP-like protein 3 [Glycine soja] 68 5e-12 ref|NP_001237350.1| CASP-like protein 2C1 [Glycine max] >gi|2885... 68 5e-12 ref|XP_003549486.1| PREDICTED: CASP-like protein 2C1 [Glycine ma... 67 1e-11 ref|XP_014508202.1| CASP-like protein 2C1 [Vigna radiata var. ra... 66 3e-11 gb|OIW18667.1| hypothetical protein TanjilG_13419 [Lupinus angus... 64 6e-11 ref|XP_019454220.1| PREDICTED: CASP-like protein 2C1 [Lupinus an... 64 2e-10 ref|XP_013441625.1| CASP POPTRDRAFT-like protein [Medicago trunc... 61 3e-09 ref|XP_002325064.1| integral membrane family protein [Populus tr... 58 1e-08 ref|XP_020227983.1| CASP-like protein 2C1 [Cajanus cajan] >gi|10... 59 2e-08 ref|XP_004507839.1| PREDICTED: CASP-like protein 2C1 [Cicer arie... 59 2e-08 sp|B9IM09.2|CSPLG_POPTR RecName: Full=CASP-like protein 2C1; Sho... 58 5e-08 gb|PIN20531.1| hypothetical protein CDL12_06773 [Handroanthus im... 55 9e-08 ref|XP_011043990.1| PREDICTED: CASP-like protein 2C1 [Populus eu... 57 9e-08 dbj|GAU21013.1| hypothetical protein TSUD_201620 [Trifolium subt... 57 1e-07 gb|POF05189.1| casp-like protein 2c1 [Quercus suber] 57 1e-07 ref|XP_023916752.1| CASP-like protein 2C1 [Quercus suber] 57 1e-07 ref|XP_022854003.1| CASP-like protein 2C1 [Olea europaea var. sy... 57 1e-07 >ref|XP_007154779.1| hypothetical protein PHAVU_003G147200g [Phaseolus vulgaris] gb|ESW26773.1| hypothetical protein PHAVU_003G147200g [Phaseolus vulgaris] Length = 180 Score = 69.3 bits (168), Expect = 2e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLK 179 I GALL G+VAS+LMAL+STISAY VFRMYSPKWF+RLK Sbjct: 140 IGGALLCGYVASILMALVSTISAYKVFRMYSPKWFLRLK 178 >ref|XP_014620633.1| PREDICTED: CASP-like protein 2C1 isoform X1 [Glycine max] gb|KRH19008.1| hypothetical protein GLYMA_13G095400 [Glycine max] Length = 155 Score = 68.2 bits (165), Expect = 3e-12 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLK 179 I GALL G+ AS+LMALISTISAY VFRMYSPKWF+RLK Sbjct: 115 IGGALLCGYAASMLMALISTISAYKVFRMYSPKWFLRLK 153 >ref|XP_017409617.1| PREDICTED: CASP-like protein 2C1 [Vigna angularis] gb|KOM29017.1| hypothetical protein LR48_Vigan627s006600 [Vigna angularis] dbj|BAT76717.1| hypothetical protein VIGAN_01476500 [Vigna angularis var. angularis] Length = 180 Score = 68.2 bits (165), Expect = 5e-12 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLK 179 I GA L G+VAS+LMALISTISAY VFRMYSPKWF+RLK Sbjct: 140 IGGAFLCGYVASILMALISTISAYRVFRMYSPKWFLRLK 178 >gb|KHN22710.1| CASP-like protein 3 [Glycine soja] Length = 180 Score = 68.2 bits (165), Expect = 5e-12 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLK 179 I GALL G+ AS+LMALISTISAY VFRMYSPKWF+RLK Sbjct: 140 IGGALLCGYAASMLMALISTISAYKVFRMYSPKWFLRLK 178 >ref|NP_001237350.1| CASP-like protein 2C1 [Glycine max] sp|C6SZ04.1|CSPL3_SOYBN RecName: Full=CASP-like protein 2C1; Short=GmCASPL2C1 gb|ACU14477.1| unknown [Glycine max] gb|KRH19007.1| hypothetical protein GLYMA_13G095400 [Glycine max] Length = 180 Score = 68.2 bits (165), Expect = 5e-12 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLK 179 I GALL G+ AS+LMALISTISAY VFRMYSPKWF+RLK Sbjct: 140 IGGALLCGYAASMLMALISTISAYKVFRMYSPKWFLRLK 178 >ref|XP_003549486.1| PREDICTED: CASP-like protein 2C1 [Glycine max] gb|KHN17582.1| CASP-like protein 3 [Glycine soja] gb|KRH02888.1| hypothetical protein GLYMA_17G064800 [Glycine max] Length = 180 Score = 67.4 bits (163), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLK 179 I GALL G+ AS++MALISTISAY VFRMYSPKWF+RLK Sbjct: 140 IGGALLCGYAASIIMALISTISAYQVFRMYSPKWFLRLK 178 >ref|XP_014508202.1| CASP-like protein 2C1 [Vigna radiata var. radiata] Length = 180 Score = 66.2 bits (160), Expect = 3e-11 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLK 179 I GA L G+VAS+LM LISTISAY VFRMYSPKWF+RLK Sbjct: 140 IGGAFLCGYVASILMLLISTISAYRVFRMYSPKWFLRLK 178 >gb|OIW18667.1| hypothetical protein TanjilG_13419 [Lupinus angustifolius] Length = 134 Score = 64.3 bits (155), Expect = 6e-11 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLKGK 173 I GA+L G+VAS+LMALIS +S Y VFRMYSPKWF+RLK + Sbjct: 94 IGGAVLCGYVASILMALISIMSTYKVFRMYSPKWFLRLKSR 134 >ref|XP_019454220.1| PREDICTED: CASP-like protein 2C1 [Lupinus angustifolius] Length = 182 Score = 64.3 bits (155), Expect = 2e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLKGK 173 I GA+L G+VAS+LMALIS +S Y VFRMYSPKWF+RLK + Sbjct: 142 IGGAVLCGYVASILMALISIMSTYKVFRMYSPKWFLRLKSR 182 >ref|XP_013441625.1| CASP POPTRDRAFT-like protein [Medicago truncatula] gb|KEH15650.1| CASP POPTRDRAFT-like protein [Medicago truncatula] Length = 184 Score = 60.8 bits (146), Expect = 3e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLKGK 173 I GA+L ++AS+LMA+ISTISAY V RMYSPK F+RLKGK Sbjct: 144 IGGAILCCYIASILMAMISTISAYKVLRMYSPKRFLRLKGK 184 >ref|XP_002325064.1| integral membrane family protein [Populus trichocarpa] Length = 98 Score = 57.8 bits (138), Expect = 1e-08 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLKG 176 I GAL G++AS+LM +IS ISA+N+FR+YSPK F+RLKG Sbjct: 58 IGGALTCGYIASVLMVMISFISAFNLFRLYSPKHFLRLKG 97 >ref|XP_020227983.1| CASP-like protein 2C1 [Cajanus cajan] gb|KYP57450.1| UPF0497 membrane protein 13 [Cajanus cajan] Length = 181 Score = 58.5 bits (140), Expect = 2e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLK 179 IA A+L G+ AS++MALISTISAY V MYSPKW +RLK Sbjct: 140 IASAVLCGYAASIIMALISTISAYKVLSMYSPKWLLRLK 178 >ref|XP_004507839.1| PREDICTED: CASP-like protein 2C1 [Cicer arietinum] Length = 182 Score = 58.5 bits (140), Expect = 2e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLKGK 173 I ALL G+VAS+LMALISTISAY VFR+YSP FMR K K Sbjct: 142 IGVALLCGYVASILMALISTISAYKVFRIYSPNCFMRFKTK 182 >sp|B9IM09.2|CSPLG_POPTR RecName: Full=CASP-like protein 2C1; Short=PtCASPL2C1 gb|PNS93567.1| hypothetical protein POPTR_018G094500v3 [Populus trichocarpa] Length = 181 Score = 57.8 bits (138), Expect = 5e-08 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLKG 176 I GAL G++AS+LM +IS ISA+N+FR+YSPK F+RLKG Sbjct: 141 IGGALTCGYIASVLMVMISFISAFNLFRLYSPKHFLRLKG 180 >gb|PIN20531.1| hypothetical protein CDL12_06773 [Handroanthus impetiginosus] Length = 103 Score = 55.5 bits (132), Expect = 9e-08 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLKGK 173 I GALL G++A++LM + S+ISAY +FR+YSPK F+ LKGK Sbjct: 63 IGGALLCGYIAAILMIITSSISAYALFRLYSPKQFLLLKGK 103 >ref|XP_011043990.1| PREDICTED: CASP-like protein 2C1 [Populus euphratica] Length = 181 Score = 57.0 bits (136), Expect = 9e-08 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLKG 176 I GAL F+AS+LMA+IS ISA+N+FR+YSPK F+RLKG Sbjct: 141 IGGALTCCFIASVLMAMISFISAFNLFRLYSPKHFLRLKG 180 >dbj|GAU21013.1| hypothetical protein TSUD_201620 [Trifolium subterraneum] Length = 184 Score = 57.0 bits (136), Expect = 1e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLKGK 173 I A L G++ASLLMA+ STISAY V RMYS K FMRLKGK Sbjct: 144 IGVAFLCGYIASLLMAVFSTISAYKVLRMYSSKRFMRLKGK 184 >gb|POF05189.1| casp-like protein 2c1 [Quercus suber] Length = 173 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLK 179 I GAL G+VAS+LMALIS ISAYN+FR YSPK F+ LK Sbjct: 133 IGGALFCGYVASILMALISFISAYNLFRNYSPKRFLHLK 171 >ref|XP_023916752.1| CASP-like protein 2C1 [Quercus suber] Length = 180 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLK 179 I GAL G+VAS+LMALIS ISAYN+FR YSPK F+ LK Sbjct: 140 IGGALFCGYVASILMALISFISAYNLFRNYSPKRFLHLK 178 >ref|XP_022854003.1| CASP-like protein 2C1 [Olea europaea var. sylvestris] Length = 181 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -2 Query: 295 IAGALLSGFVASLLMALISTISAYNVFRMYSPKWFMRLKGK 173 I GALL + AS+ MA+IS+ISAYN+FR YSPK F+ LKGK Sbjct: 141 IVGALLCAYCASIFMAVISSISAYNLFRFYSPKKFLLLKGK 181