BLASTX nr result
ID: Astragalus23_contig00024324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00024324 (377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU27876.1| hypothetical protein TSUD_159700 [Trifolium subt... 133 1e-33 gb|PNX78642.1| receptor-like protein kinase, partial [Trifolium ... 114 2e-27 ref|XP_012567802.1| PREDICTED: pentatricopeptide repeat-containi... 113 1e-26 gb|KOM56592.1| hypothetical protein LR48_Vigan10g248400 [Vigna a... 103 3e-26 ref|XP_009800403.1| PREDICTED: leucine-rich repeat extensin-like... 102 2e-25 dbj|BAT82265.1| hypothetical protein VIGAN_03224900 [Vigna angul... 103 2e-25 gb|KOM54435.1| hypothetical protein LR48_Vigan10g032700 [Vigna a... 102 4e-25 dbj|BAT79052.1| hypothetical protein VIGAN_02185400, partial [Vi... 98 7e-24 gb|ABI34329.1| Integrase core domain containing protein [Solanum... 104 2e-23 gb|KOM58362.1| hypothetical protein LR48_Vigan11g139600 [Vigna a... 103 3e-23 gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposo... 103 5e-23 dbj|BAT73483.1| hypothetical protein VIGAN_01097100, partial [Vi... 97 1e-22 gb|ABI34342.1| Polyprotein, putative [Solanum demissum] 101 2e-22 dbj|BAT76296.1| hypothetical protein VIGAN_01427700, partial [Vi... 94 2e-22 ref|XP_016561600.1| PREDICTED: protein RST1 isoform X3 [Capsicum... 101 2e-22 dbj|BAU03608.1| hypothetical protein VIGAN_UM141900, partial [Vi... 94 3e-22 gb|OIT39937.1| retrovirus-related pol polyprotein from transposo... 100 3e-22 dbj|GAU47864.1| hypothetical protein TSUD_404350 [Trifolium subt... 100 5e-22 gb|KOM38790.1| hypothetical protein LR48_Vigan03g217200 [Vigna a... 100 5e-22 gb|KOM33846.1| hypothetical protein LR48_Vigan01g340200 [Vigna a... 98 5e-22 >dbj|GAU27876.1| hypothetical protein TSUD_159700 [Trifolium subterraneum] Length = 1257 Score = 133 bits (335), Expect = 1e-33 Identities = 69/109 (63%), Positives = 76/109 (69%), Gaps = 3/109 (2%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHNLS GLDKLSARSLKCVFLGYHRSQKGYRCYSPTL+RYL+SADVTFFES+PY+E N Sbjct: 502 CFVHNLSPGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLKRYLVSADVTFFESIPYFEPN 561 Query: 239 HLSPEPLSAVIPISNLPPVISPLE---TVTLXXXXXXXXXXXXLQTYHR 376 + PEPL + P I PLE +V LQTY R Sbjct: 562 KMIPEPLQDMNPEPTQEVTIVPLEPCQSVPPDTPPVAPPTSQPLQTYQR 610 >gb|PNX78642.1| receptor-like protein kinase, partial [Trifolium pratense] Length = 426 Score = 114 bits (285), Expect = 2e-27 Identities = 62/86 (72%), Positives = 69/86 (80%), Gaps = 2/86 (2%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHNLS LDKLSARSLK VFLGYH SQKGYR YSPTLQRYL+SADVTFFESVPY+E+N Sbjct: 93 CFVHNLSPSLDKLSARSLKNVFLGYHWSQKGYR-YSPTLQRYLVSADVTFFESVPYFETN 151 Query: 239 HLSPEPLSAV--IPISNLPPVISPLE 310 ++ EPL + PI +P I PLE Sbjct: 152 KMTREPLQDINLEPIQEVP--IVPLE 175 >ref|XP_012567802.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63400-like [Cicer arietinum] Length = 692 Score = 113 bits (283), Expect = 1e-26 Identities = 58/94 (61%), Positives = 66/94 (70%), Gaps = 8/94 (8%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHN+S GLDKLSARSLKCVFLGYHRSQKGY CY P L RY+ SADVTFFES+ Y++ Sbjct: 55 CFVHNVSPGLDKLSARSLKCVFLGYHRSQKGYCCYFPALHRYVTSADVTFFESISYFKPT 114 Query: 239 HLSPEPL--------SAVIPISNLPPVISPLETV 316 H++ EP VIP LPP P+E V Sbjct: 115 HIAIEPYQDINHEPPQVVIP---LPPTHIPIEPV 145 >gb|KOM56592.1| hypothetical protein LR48_Vigan10g248400 [Vigna angularis] Length = 120 Score = 103 bits (258), Expect = 3e-26 Identities = 46/82 (56%), Positives = 61/82 (74%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHN+S GLDKLS +S+KCVFLGY R QKGYRCYSP+ +RY +S+DVTFFE P++ S+ Sbjct: 33 CFVHNVSPGLDKLSPKSIKCVFLGYSRIQKGYRCYSPSTRRYYMSSDVTFFEDTPFFLSS 92 Query: 239 HLSPEPLSAVIPISNLPPVISP 304 P + ++PI P++ P Sbjct: 93 KEYPSSVEEMLPIPLCDPLVIP 114 >ref|XP_009800403.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Nicotiana sylvestris] Length = 138 Score = 102 bits (255), Expect = 2e-25 Identities = 51/92 (55%), Positives = 63/92 (68%), Gaps = 10/92 (10%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHN + G DKL+ R+LKCVFLGY R QKGYRCYSP LQRYL+SADVTFFE+ Y+ Sbjct: 33 CFVHNFTPGKDKLAPRALKCVFLGYSRKQKGYRCYSPDLQRYLMSADVTFFETQSYFTGP 92 Query: 239 HLSP----------EPLSAVIPISNLPPVISP 304 P P++A PI+++PP I+P Sbjct: 93 APPPTAPVAAPPPTAPVAAPPPIASVPPPIAP 124 >dbj|BAT82265.1| hypothetical protein VIGAN_03224900 [Vigna angularis var. angularis] Length = 184 Score = 103 bits (258), Expect = 2e-25 Identities = 45/82 (54%), Positives = 61/82 (74%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHN+S GLDKLS +S+KCVFLGY R QKGYRCYSP+ +RY +S+DVTFFE P++ S+ Sbjct: 33 CFVHNVSPGLDKLSPKSIKCVFLGYSRIQKGYRCYSPSTRRYYMSSDVTFFEDTPFFLSS 92 Query: 239 HLSPEPLSAVIPISNLPPVISP 304 + ++PI + P++ P Sbjct: 93 KEDRSSIQEILPIPSCDPLVIP 114 >gb|KOM54435.1| hypothetical protein LR48_Vigan10g032700 [Vigna angularis] Length = 160 Score = 102 bits (254), Expect = 4e-25 Identities = 45/82 (54%), Positives = 60/82 (73%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHN+S GLDKLSA+++KCVFLGY R QKGY+CYSP+ +RY +SADVTFFE P++ S+ Sbjct: 57 CFVHNVSPGLDKLSAKAIKCVFLGYSRLQKGYKCYSPSTKRYYMSADVTFFEDTPFFPSS 116 Query: 239 HLSPEPLSAVIPISNLPPVISP 304 + + P+ P+I P Sbjct: 117 MEDRSSVQQMFPLPTCDPLIIP 138 >dbj|BAT79052.1| hypothetical protein VIGAN_02185400, partial [Vigna angularis var. angularis] Length = 111 Score = 97.8 bits (242), Expect = 7e-24 Identities = 45/73 (61%), Positives = 55/73 (75%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVH++S GLDKLSAR+LKCVFLGY R QKGYRCYSP ++Y +SA+VTFFE PY+ + Sbjct: 33 CFVHDMSPGLDKLSARALKCVFLGYSRLQKGYRCYSPETKKYYMSANVTFFEQTPYFSPS 92 Query: 239 HLSPEPLSAVIPI 277 L V+PI Sbjct: 93 VQDVSILQQVLPI 105 >gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum] Length = 1775 Score = 104 bits (260), Expect = 2e-23 Identities = 62/108 (57%), Positives = 71/108 (65%), Gaps = 2/108 (1%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYY-ES 235 CFVHNL+ G DKL+ R+LKCVFLGY R QKGYRCYS L RYL+SADVTFFES PYY S Sbjct: 715 CFVHNLAPGKDKLAPRALKCVFLGYSRVQKGYRCYSHDLHRYLMSADVTFFESQPYYTSS 774 Query: 236 NHLSPEPLSAVIPISNLPPVISPLE-TVTLXXXXXXXXXXXXLQTYHR 376 NH +S V+PI + PV + +E TVT L TYHR Sbjct: 775 NH---PDVSMVLPIPQVLPVPTFVESTVT----STSPVVVPPLLTYHR 815 >gb|KOM58362.1| hypothetical protein LR48_Vigan11g139600 [Vigna angularis] Length = 492 Score = 103 bits (256), Expect = 3e-23 Identities = 45/82 (54%), Positives = 60/82 (73%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHN+SLGLDK+SA+++KCVFLGY R QKGY+CYSP+ +RY +SADVTFFE P++ S+ Sbjct: 138 CFVHNVSLGLDKVSAKAIKCVFLGYSRLQKGYKCYSPSTKRYYMSADVTFFEDTPFFPSS 197 Query: 239 HLSPEPLSAVIPISNLPPVISP 304 + P+ P+I P Sbjct: 198 MEGRSSTQQMFPLPTCDPLIIP 219 >gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 1353 Score = 103 bits (256), Expect = 5e-23 Identities = 50/85 (58%), Positives = 62/85 (72%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHNLS GLDKLSAR++KCVFLGY R QKGY+C+SP+ +RY +SADVTFFE P+Y S+ Sbjct: 657 CFVHNLSPGLDKLSARAIKCVFLGYSRLQKGYKCFSPSTRRYYMSADVTFFEDTPFYPSS 716 Query: 239 HLSPEPLSAVIPISNLPPVISPLET 313 + V+PI P PL+T Sbjct: 717 TDHSSSIQNVLPI----PSPCPLDT 737 >dbj|BAT73483.1| hypothetical protein VIGAN_01097100, partial [Vigna angularis var. angularis] Length = 198 Score = 97.1 bits (240), Expect = 1e-22 Identities = 48/82 (58%), Positives = 58/82 (70%), Gaps = 3/82 (3%) Frame = +2 Query: 41 TCLRVH---CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFF 211 TC RV CFVHN+S GLDKLSAR+LKCVFLGY R QKGY+CYSP ++Y +S +VTFF Sbjct: 24 TCPRVFGCVCFVHNMSPGLDKLSARALKCVFLGYSRLQKGYQCYSPETKKYYMSVNVTFF 83 Query: 212 ESVPYYESNHLSPEPLSAVIPI 277 E PY+ + L V+PI Sbjct: 84 EQTPYFFPSVQDISILQQVLPI 105 >gb|ABI34342.1| Polyprotein, putative [Solanum demissum] Length = 1054 Score = 101 bits (252), Expect = 2e-22 Identities = 51/79 (64%), Positives = 59/79 (74%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHNL+ G DKL+ R+LKCVFLGY R QKGYRCYS L RYL+SADVTFFES PYY S+ Sbjct: 476 CFVHNLAPGKDKLAPRALKCVFLGYSRVQKGYRCYSHDLHRYLMSADVTFFESQPYYTSS 535 Query: 239 HLSPEPLSAVIPISNLPPV 295 +S V+PI + PV Sbjct: 536 --DHPDVSMVLPIPQVLPV 552 >dbj|BAT76296.1| hypothetical protein VIGAN_01427700, partial [Vigna angularis var. angularis] Length = 125 Score = 94.4 bits (233), Expect = 2e-22 Identities = 42/73 (57%), Positives = 55/73 (75%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVH++S GLDKLSAR++KCVFLGY R QKGYRCYSP ++Y +SA+VTFFE P++ + Sbjct: 33 CFVHDMSPGLDKLSARAIKCVFLGYSRLQKGYRCYSPETKKYYMSANVTFFEQTPFFSPS 92 Query: 239 HLSPEPLSAVIPI 277 L V+P+ Sbjct: 93 VQDVHILHQVLPL 105 >ref|XP_016561600.1| PREDICTED: protein RST1 isoform X3 [Capsicum annuum] Length = 1689 Score = 101 bits (251), Expect = 2e-22 Identities = 61/108 (56%), Positives = 69/108 (63%), Gaps = 2/108 (1%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYES- 235 CFVHNL+ G DKL+ R+LKCVFLGY R QKGYRCY P L RYL+SADVTFFES PYY S Sbjct: 33 CFVHNLAPGKDKLAPRALKCVFLGYSRVQKGYRCYLPDLGRYLMSADVTFFESQPYYTSF 92 Query: 236 NHLSPEPLSAVIPISN-LPPVISPLETVTLXXXXXXXXXXXXLQTYHR 376 ++L +S V+PI LP I TVT L TYHR Sbjct: 93 DYLD---ISEVLPIPPVLPTPIFEESTVT----SPSPATVPSLLTYHR 133 >dbj|BAU03608.1| hypothetical protein VIGAN_UM141900, partial [Vigna angularis var. angularis] Length = 133 Score = 94.4 bits (233), Expect = 3e-22 Identities = 42/73 (57%), Positives = 55/73 (75%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVH++S GLDKLSAR++KCVFLGY R QKGYRCYSP ++Y +SA+VTFFE P++ + Sbjct: 33 CFVHDMSPGLDKLSARAIKCVFLGYSRLQKGYRCYSPETKKYYMSANVTFFEQTPFFSPS 92 Query: 239 HLSPEPLSAVIPI 277 L V+P+ Sbjct: 93 VQDVHILHQVLPL 105 >gb|OIT39937.1| retrovirus-related pol polyprotein from transposon tnt 1-94 [Nicotiana attenuata] Length = 2608 Score = 100 bits (250), Expect = 3e-22 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 18/101 (17%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYY--E 232 CFVHNL+ G DKL+ R+LKCVFLGY R QKGYRCYSP LQRYL+S DVTFFE+ Y+ Sbjct: 1770 CFVHNLTPGKDKLAPRALKCVFLGYSRKQKGYRCYSPDLQRYLMSVDVTFFETQSYFTGP 1829 Query: 233 SNHLSPEPLSAVIPISNL----------------PPVISPL 307 NHL +S V+P+S+ PP+I+P+ Sbjct: 1830 GNHLD---ISEVLPVSSFGDSVTISHSSSSTTPAPPLIAPV 1867 >dbj|GAU47864.1| hypothetical protein TSUD_404350 [Trifolium subterraneum] Length = 1118 Score = 100 bits (249), Expect = 5e-22 Identities = 48/88 (54%), Positives = 64/88 (72%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVH+L+ G DKL+A+SLKC+FLGY R QKGYRCYSP L+RY++SADV+FFES P++ S Sbjct: 573 CFVHDLTPGKDKLAAKSLKCLFLGYSRLQKGYRCYSPDLRRYIVSADVSFFESRPFFPST 632 Query: 239 HLSPEPLSAVIPISNLPPVISPLETVTL 322 EP + + + LP +P+ TL Sbjct: 633 --PKEPNDSSLEVMTLPSAPTPVVIPTL 658 >gb|KOM38790.1| hypothetical protein LR48_Vigan03g217200 [Vigna angularis] Length = 1119 Score = 100 bits (249), Expect = 5e-22 Identities = 45/82 (54%), Positives = 60/82 (73%) Frame = +2 Query: 59 CFVHNLSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESN 238 CFVHN+S GLDKLS +S+KCVFLGY R QKGYRCYSP+ +R +S+DVTFFE P++ S+ Sbjct: 429 CFVHNVSPGLDKLSPKSIKCVFLGYSRIQKGYRCYSPSTRRNYMSSDVTFFEDTPFFLSS 488 Query: 239 HLSPEPLSAVIPISNLPPVISP 304 P + ++PI P++ P Sbjct: 489 KEYPSSVEEMLPIPLCDPLVIP 510 >gb|KOM33846.1| hypothetical protein LR48_Vigan01g340200 [Vigna angularis] Length = 327 Score = 98.2 bits (243), Expect = 5e-22 Identities = 46/78 (58%), Positives = 59/78 (75%), Gaps = 4/78 (5%) Frame = +2 Query: 74 LSLGLDKLSARSLKCVFLGYHRSQKGYRCYSPTLQRYLISADVTFFESVPYYESNHLSPE 253 +SLGLDKLSAR++KCVFLGY R QKGYRCYSP ++Y +SA+VTFFE PY+ S+ E Sbjct: 1 MSLGLDKLSARAIKCVFLGYSRLQKGYRCYSPETKKYFMSANVTFFEQTPYFTSSEQEIE 60 Query: 254 PLSAVIPI----SNLPPV 295 + V+P+ SN+PPV Sbjct: 61 VIQQVLPLPIIESNIPPV 78