BLASTX nr result
ID: Astragalus23_contig00013900
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00013900 (606 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603942.1| SNF1-related kinase regulatory subunit gamma... 72 3e-11 ref|XP_004500805.1| PREDICTED: SNF1-related protein kinase regul... 70 1e-10 ref|XP_020210578.1| SNF1-related protein kinase regulatory subun... 68 7e-10 ref|XP_014632675.1| PREDICTED: SNF1-related protein kinase regul... 65 4e-09 gb|KHN20062.1| SNF1-related protein kinase regulatory subunit ga... 65 6e-09 gb|KRH51517.1| hypothetical protein GLYMA_06G011800 [Glycine max] 65 6e-09 ref|XP_014630515.1| PREDICTED: SNF1-related protein kinase regul... 63 8e-09 gb|KRH60826.1| hypothetical protein GLYMA_04G012000 [Glycine max] 63 4e-08 gb|KHN33747.1| SNF1-related protein kinase regulatory subunit ga... 63 4e-08 ref|XP_007136161.1| hypothetical protein PHAVU_009G023200g [Phas... 61 2e-07 gb|KOM42332.1| hypothetical protein LR48_Vigan04g253000 [Vigna a... 61 2e-07 ref|XP_017422253.1| PREDICTED: SNF1-related protein kinase regul... 61 2e-07 ref|XP_014499409.1| SNF1-related protein kinase regulatory subun... 61 2e-07 ref|XP_022636782.1| SNF1-related protein kinase regulatory subun... 59 1e-06 >ref|XP_003603942.1| SNF1-related kinase regulatory subunit gamma 1 [Medicago truncatula] gb|AES74193.1| SNF1-related kinase regulatory subunit gamma 1 [Medicago truncatula] Length = 419 Score = 72.0 bits (175), Expect = 3e-11 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFEGQEH S VFGDQTV DALKLLWQNQTCAVAVV + TK Sbjct: 227 RFEGQEHLSCVFGDQTVADALKLLWQNQTCAVAVVDRQTK 266 >ref|XP_004500805.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Cicer arietinum] Length = 418 Score = 70.1 bits (170), Expect = 1e-10 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFEGQE PS VFGDQTV ALKLLWQNQTCAVAVV + TK Sbjct: 226 RFEGQERPSCVFGDQTVAHALKLLWQNQTCAVAVVDRQTK 265 >ref|XP_020210578.1| SNF1-related protein kinase regulatory subunit gamma-1-like [Cajanus cajan] gb|KYP75195.1| SNF1-related protein kinase regulatory subunit gamma 1 [Cajanus cajan] Length = 426 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFEGQE PS V+GDQ+V DALKLLWQNQTCAVAVV + TK Sbjct: 234 RFEGQESPSCVYGDQSVSDALKLLWQNQTCAVAVVDRMTK 273 >ref|XP_014632675.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Glycine max] Length = 295 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFE QE+PS V+GDQTV +AL LLWQNQTCAVAVV + TK Sbjct: 103 RFESQENPSCVYGDQTVANALDLLWQNQTCAVAVVDRQTK 142 >gb|KHN20062.1| SNF1-related protein kinase regulatory subunit gamma-1 [Glycine soja] Length = 436 Score = 65.5 bits (158), Expect = 6e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFE QE+PS V+GDQTV +AL LLWQNQTCAVAVV + TK Sbjct: 244 RFESQENPSCVYGDQTVANALDLLWQNQTCAVAVVDRQTK 283 >gb|KRH51517.1| hypothetical protein GLYMA_06G011800 [Glycine max] Length = 436 Score = 65.5 bits (158), Expect = 6e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFE QE+PS V+GDQTV +AL LLWQNQTCAVAVV + TK Sbjct: 244 RFESQENPSCVYGDQTVANALDLLWQNQTCAVAVVDRQTK 283 >ref|XP_014630515.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Glycine max] Length = 171 Score = 62.8 bits (151), Expect = 8e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFE QE+PS V+GDQTV +AL +LWQNQTC VAVV + TK Sbjct: 64 RFESQENPSCVYGDQTVANALDMLWQNQTCPVAVVDRQTK 103 >gb|KRH60826.1| hypothetical protein GLYMA_04G012000 [Glycine max] Length = 346 Score = 62.8 bits (151), Expect = 4e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFE QE+PS V+GDQTV +AL +LWQNQTC VAVV + TK Sbjct: 219 RFESQENPSCVYGDQTVANALDMLWQNQTCPVAVVDRQTK 258 >gb|KHN33747.1| SNF1-related protein kinase regulatory subunit gamma-1 [Glycine soja] Length = 353 Score = 62.8 bits (151), Expect = 4e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFE QE+PS V+GDQTV +AL +LWQNQTC VAVV + TK Sbjct: 219 RFESQENPSCVYGDQTVANALDMLWQNQTCPVAVVDRQTK 258 >ref|XP_007136161.1| hypothetical protein PHAVU_009G023200g [Phaseolus vulgaris] gb|ESW08155.1| hypothetical protein PHAVU_009G023200g [Phaseolus vulgaris] Length = 431 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFEGQE+PS VF DQ+V DALK LWQNQT VAVV + TK Sbjct: 239 RFEGQENPSCVFADQSVADALKSLWQNQTTPVAVVDRETK 278 >gb|KOM42332.1| hypothetical protein LR48_Vigan04g253000 [Vigna angularis] Length = 395 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFEG E+PS VF DQTV DALK WQNQT AVAVV + TK Sbjct: 203 RFEGLENPSCVFSDQTVADALKTFWQNQTSAVAVVDRQTK 242 >ref|XP_017422253.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Vigna angularis] dbj|BAT77494.1| hypothetical protein VIGAN_02007500 [Vigna angularis var. angularis] Length = 426 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFEG E+PS VF DQTV DALK WQNQT AVAVV + TK Sbjct: 234 RFEGLENPSCVFSDQTVADALKTFWQNQTSAVAVVDRQTK 273 >ref|XP_014499409.1| SNF1-related protein kinase regulatory subunit gamma-1-like isoform X1 [Vigna radiata var. radiata] Length = 426 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -1 Query: 597 RFEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 RFEG E+PS VF DQTV DALK WQNQT AVAVV + TK Sbjct: 234 RFEGLENPSCVFSDQTVADALKTFWQNQTSAVAVVDRQTK 273 >ref|XP_022636782.1| SNF1-related protein kinase regulatory subunit gamma-1-like isoform X2 [Vigna radiata var. radiata] Length = 422 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -1 Query: 594 FEGQEHPSIVFGDQTVVDALKLLWQNQTCAVAVVHKHTK 478 FEG E+PS VF DQTV DALK WQNQT AVAVV + TK Sbjct: 231 FEGLENPSCVFSDQTVADALKTFWQNQTSAVAVVDRQTK 269