BLASTX nr result
ID: Astragalus23_contig00013580
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00013580 (1276 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY05166.1| pentatricopeptide repeat-containing protein at4g3... 69 1e-08 ref|XP_003610281.1| pentatricopeptide (PPR) repeat protein [Medi... 67 5e-08 dbj|GAU11028.1| hypothetical protein TSUD_113210 [Trifolium subt... 63 6e-08 dbj|GAU18294.1| hypothetical protein TSUD_201820 [Trifolium subt... 64 2e-07 dbj|GAU17406.1| hypothetical protein TSUD_232820 [Trifolium subt... 62 9e-07 ref|XP_004507756.1| PREDICTED: pentatricopeptide repeat-containi... 60 9e-06 >gb|PNY05166.1| pentatricopeptide repeat-containing protein at4g30700-like protein [Trifolium pratense] Length = 783 Score = 68.6 bits (166), Expect = 1e-08 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 958 DGMPEGYRVVDSSTVTAVLPAAAELQELRVGMRIRCLALKIGFQSCEHV 812 D + EG R+ DSSTVTAVLPA AELQELRVGM I+CLALKIGF C++V Sbjct: 199 DMVAEGVRL-DSSTVTAVLPAVAELQELRVGMGIQCLALKIGFNRCDYV 246 >ref|XP_003610281.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AES92478.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 783 Score = 66.6 bits (161), Expect = 5e-08 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 931 VDSSTVTAVLPAAAELQELRVGMRIRCLALKIGFQSCEHV 812 VDSSTVTAVLPAAAELQEL+VGM I+CLALKIGF C++V Sbjct: 207 VDSSTVTAVLPAAAELQELKVGMGIQCLALKIGFGFCDYV 246 >dbj|GAU11028.1| hypothetical protein TSUD_113210 [Trifolium subterraneum] Length = 186 Score = 63.2 bits (152), Expect = 6e-08 Identities = 38/66 (57%), Positives = 45/66 (68%) Frame = -1 Query: 958 DGMPEGYRVVDSSTVTAVLPAAAELQELRVGMRIRCLALKIGFQSCEHVQGVIDVILLTL 779 D + +G R+ DSSTVT VLPA AELQELRVGM I+CL LKIGF C +V L L Sbjct: 31 DMIAQGVRL-DSSTVTVVLPAVAELQELRVGMGIQCLTLKIGFNRCVYV-------LTGL 82 Query: 778 NTLKAE 761 N+L A+ Sbjct: 83 NSLYAK 88 >dbj|GAU18294.1| hypothetical protein TSUD_201820 [Trifolium subterraneum] Length = 448 Score = 64.3 bits (155), Expect = 2e-07 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 931 VDSSTVTAVLPAAAELQELRVGMRIRCLALKIGFQSCEHV 812 +DSS VTAVLPA AELQELRVGM I+CLALKIGF C++V Sbjct: 207 LDSSAVTAVLPAVAELQELRVGMGIQCLALKIGFNRCDYV 246 >dbj|GAU17406.1| hypothetical protein TSUD_232820 [Trifolium subterraneum] Length = 369 Score = 62.0 bits (149), Expect = 9e-07 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 958 DGMPEGYRVVDSSTVTAVLPAAAELQELRVGMRIRCLALKIGFQSCEHV 812 D + +G R+ DSSTV AVL A AELQELRVGM I+CLALKIGF SC +V Sbjct: 199 DMIAQGVRL-DSSTVNAVLSAFAELQELRVGMGIQCLALKIGFNSCVYV 246 >ref|XP_004507756.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Cicer arietinum] Length = 783 Score = 59.7 bits (143), Expect = 9e-06 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = -1 Query: 970 QNLFDGMPEGYRVVDSSTVTAVLPAAAELQELRVGMRIRCLALKIGFQSCEHV 812 Q D + EG R DS+TVTAVLPA AELQELRVGM I+CLALK GF ++V Sbjct: 195 QLFVDMVAEGVRF-DSTTVTAVLPAVAELQELRVGMGIQCLALKKGFHFYDYV 246