BLASTX nr result
ID: Astragalus23_contig00012559
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00012559 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX81323.1| F-box protein [Trifolium pratense] 63 4e-10 ref|XP_004512128.1| PREDICTED: F-box protein At3g07870-like [Cic... 65 1e-09 ref|XP_013453551.1| F-box protein interaction domain protein [Me... 64 2e-09 ref|XP_003612244.2| F-box protein interaction domain protein [Me... 63 7e-09 ref|XP_013449582.1| F-box protein interaction domain protein [Me... 62 1e-08 gb|PNX88716.1| F-box family protein [Trifolium pratense] 62 1e-08 gb|PNY09680.1| F-box family protein [Trifolium pratense] 62 2e-08 ref|XP_003610871.2| F-box protein interaction domain protein [Me... 61 2e-08 ref|XP_019454515.1| PREDICTED: F-box/kelch-repeat protein At3g06... 60 6e-08 ref|XP_003612169.2| F-box protein interaction domain protein [Me... 60 6e-08 ref|XP_003612153.1| F-box protein interaction domain protein [Me... 60 8e-08 ref|XP_013453553.1| F-box protein interaction domain protein [Me... 59 1e-07 gb|AFK40065.1| unknown [Medicago truncatula] 58 3e-07 dbj|GAU36234.1| hypothetical protein TSUD_214310 [Trifolium subt... 56 1e-06 ref|XP_003612151.2| F-box protein interaction domain protein [Me... 56 2e-06 ref|XP_003612229.2| F-box protein interaction domain protein [Me... 55 2e-06 gb|AFK37781.1| unknown [Lotus japonicus] 55 5e-06 dbj|GAU24035.1| hypothetical protein TSUD_328390 [Trifolium subt... 54 8e-06 >gb|PNX81323.1| F-box protein [Trifolium pratense] Length = 131 Score = 63.2 bits (152), Expect = 4e-10 Identities = 31/43 (72%), Positives = 39/43 (90%), Gaps = 2/43 (4%) Frame = -1 Query: 375 VIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVLFV 253 VIPHIPSL+SLKDVV GDNI VL+++SRC FKL++E+EVLF+ Sbjct: 75 VIPHIPSLISLKDVVKGDNIEVLSIHSRCAKFKLQKENEVLFL 117 >ref|XP_004512128.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] ref|XP_004512171.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] ref|XP_012574463.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] ref|XP_012574465.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] Length = 488 Score = 65.1 bits (157), Expect = 1e-09 Identities = 33/42 (78%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 259 EVIPHIPSL+SLKDVV GDNI VLN++SRC FKL EE+EVL Sbjct: 431 EVIPHIPSLISLKDVVKGDNIEVLNIHSRCTKFKLPEENEVL 472 >ref|XP_013453551.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH27584.1| F-box protein interaction domain protein [Medicago truncatula] Length = 496 Score = 64.3 bits (155), Expect = 2e-09 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 259 EVIPHIPSL+SLKDV+ GDNI VLN++SRC FKL+EE EVL Sbjct: 445 EVIPHIPSLISLKDVLKGDNIEVLNIHSRCAKFKLREEKEVL 486 >ref|XP_003612244.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95202.2| F-box protein interaction domain protein [Medicago truncatula] Length = 482 Score = 62.8 bits (151), Expect = 7e-09 Identities = 31/42 (73%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 259 EVIPHIPSL+SLKDV+ GDNI VLN++SRC FKL+EE +VL Sbjct: 434 EVIPHIPSLISLKDVLKGDNIEVLNIHSRCAKFKLREERDVL 475 >ref|XP_013449582.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH23610.1| F-box protein interaction domain protein [Medicago truncatula] Length = 305 Score = 62.0 bits (149), Expect = 1e-08 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVLFV 253 EVIPHIPSL+SLKDVV GDNI V +++SRC +KL EE EVLF+ Sbjct: 257 EVIPHIPSLISLKDVVKGDNIEVFSIHSRCAKYKLWEESEVLFL 300 >gb|PNX88716.1| F-box family protein [Trifolium pratense] Length = 272 Score = 61.6 bits (148), Expect = 1e-08 Identities = 31/41 (75%), Positives = 36/41 (87%), Gaps = 2/41 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEV 262 EVI HIPSL+SLKDVV GDNI VLN++SRC FKL+EE+EV Sbjct: 213 EVISHIPSLISLKDVVKGDNIEVLNIHSRCAKFKLREENEV 253 >gb|PNY09680.1| F-box family protein [Trifolium pratense] Length = 478 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 259 E+IPHIPSL+SLKDV+ GDNI V N++SRC FKL+EE+E L Sbjct: 372 EIIPHIPSLISLKDVIKGDNIEVQNIHSRCAKFKLREENETL 413 >ref|XP_003610871.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES93829.2| F-box protein interaction domain protein [Medicago truncatula] Length = 448 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/42 (71%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 259 E+IPHIPSL+SLKDV+ GDNI VLN++SRC FKL+EE E L Sbjct: 400 EIIPHIPSLISLKDVLKGDNIEVLNIHSRCAKFKLREETEGL 441 >ref|XP_019454515.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like isoform X1 [Lupinus angustifolius] Length = 468 Score = 60.1 bits (144), Expect = 6e-08 Identities = 29/44 (65%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVLFV 253 EV PHIPSL+SLKD V G+N+ VLNV+ RC FKL+EE+E LF+ Sbjct: 424 EVFPHIPSLISLKDAVKGNNVEVLNVHLRCAKFKLREENEALFL 467 >ref|XP_003612169.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95127.2| F-box protein interaction domain protein [Medicago truncatula] Length = 490 Score = 60.1 bits (144), Expect = 6e-08 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 259 E+IPH+PSL+SLKDVV GDNI VLN++SRC +L EE+EVL Sbjct: 442 EIIPHVPSLISLKDVVKGDNIEVLNIHSRCANVELPEENEVL 483 >ref|XP_003612153.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES95111.1| F-box protein interaction domain protein [Medicago truncatula] Length = 507 Score = 59.7 bits (143), Expect = 8e-08 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 4/46 (8%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC----FKLKEEDEVLFV 253 EVIPHIPSL+SLKDV+ GDNI VLN++SRC F L EE+E L V Sbjct: 445 EVIPHIPSLISLKDVLKGDNIEVLNIHSRCVFKFFNLHEENEDLVV 490 >ref|XP_013453553.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH27586.1| F-box protein interaction domain protein [Medicago truncatula] Length = 459 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/42 (66%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 259 E+IPH+PSL+SLKDVV GDN +LN++SRC KL+EE+EVL Sbjct: 411 EIIPHVPSLISLKDVVKGDNTEMLNIHSRCANVKLEEENEVL 452 >gb|AFK40065.1| unknown [Medicago truncatula] Length = 479 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 259 EVIPHIPSL+SLKDV+ G NI VLN++SRC FKL+ E EVL Sbjct: 431 EVIPHIPSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKEVL 472 >dbj|GAU36234.1| hypothetical protein TSUD_214310 [Trifolium subterraneum] Length = 357 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 2/38 (5%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEE 271 EVIPHIPSL+SLKD V DN+ VLNVNSRC FKL EE Sbjct: 320 EVIPHIPSLISLKDAVRRDNVDVLNVNSRCAKFKLPEE 357 >ref|XP_003612151.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95109.2| F-box protein interaction domain protein [Medicago truncatula] Length = 512 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVL 259 EVIPHIPSL+SLKDV+ G NI VLN++SRC FKL+ E E L Sbjct: 431 EVIPHIPSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKESL 472 >ref|XP_003612229.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95187.2| F-box protein interaction domain protein [Medicago truncatula] Length = 423 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 3/42 (7%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNS-RC--FKLKEEDEV 262 EVIPHIPSL+SLK+ V GDN+ VLNV S RC FKL+EE EV Sbjct: 352 EVIPHIPSLISLKEAVNGDNVEVLNVYSRRCAKFKLREESEV 393 >gb|AFK37781.1| unknown [Lotus japonicus] Length = 489 Score = 54.7 bits (130), Expect = 5e-06 Identities = 29/44 (65%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -1 Query: 378 EVIPHIPSLVSLKDVVIGDNIRVLNVNSRC--FKLKEEDEVLFV 253 +VIPHIPS +SLKDVV GDNI VLNV+SR FK EE+ LF+ Sbjct: 427 DVIPHIPSFISLKDVVKGDNIEVLNVHSRYEEFKFMEENADLFL 470 >dbj|GAU24035.1| hypothetical protein TSUD_328390 [Trifolium subterraneum] Length = 341 Score = 53.9 bits (128), Expect = 8e-06 Identities = 28/44 (63%), Positives = 37/44 (84%), Gaps = 3/44 (6%) Frame = -1 Query: 375 VIPHIPSLVSLKDVVI-GDNIRVLNVNSRC--FKLKEEDEVLFV 253 VIPHIPSL+SLKD+V GDN VL+++SRC +KL E++EVLF+ Sbjct: 283 VIPHIPSLISLKDIVKGGDNNEVLSIHSRCAKYKLPEDNEVLFL 326