BLASTX nr result
ID: Astragalus23_contig00007475
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00007475 (318 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616246.1| hypothetical protein MTR_5g077760 [Medicago ... 64 2e-11 gb|OIW04441.1| hypothetical protein TanjilG_32633 [Lupinus angus... 55 1e-07 >ref|XP_003616246.1| hypothetical protein MTR_5g077760 [Medicago truncatula] gb|AES99204.1| hypothetical protein MTR_5g077760 [Medicago truncatula] Length = 71 Score = 64.3 bits (155), Expect = 2e-11 Identities = 34/55 (61%), Positives = 38/55 (69%) Frame = +3 Query: 9 LSSFVETIAQFFATSQSHFXXXXXXNMLMNMKKKDASLSANATAQKHFRKIQHTC 173 LS FVE+IAQ F TSQSHF NM MN +K+DAS AN AQ HFR+IQH C Sbjct: 18 LSCFVESIAQHFDTSQSHFTSTSKVNM-MNKEKEDASTIANVAAQNHFRQIQHFC 71 >gb|OIW04441.1| hypothetical protein TanjilG_32633 [Lupinus angustifolius] Length = 73 Score = 54.7 bits (130), Expect = 1e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +3 Query: 6 LLSSFVETIAQFF---ATSQSHFXXXXXXNMLMNMKKKDASLSANATAQKHFRKIQHTC 173 LLS F+E+I Q F A S+SHF NM M+M+K S +AN AQKHFR+IQH C Sbjct: 16 LLSYFMESITQLFGSKAASKSHFSIDCEENM-MDMRKGGVSNAANVAAQKHFRQIQHMC 73