BLASTX nr result
ID: Astragalus23_contig00004117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00004117 (314 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013452154.1| C2 domain protein [Medicago truncatula] >gi|... 65 3e-10 gb|PNX88030.1| putative peroxisomal membrane protein PEX13-like ... 61 9e-09 dbj|GAU24599.1| hypothetical protein TSUD_289600 [Trifolium subt... 59 4e-08 ref|XP_003549032.1| PREDICTED: protein SRC2-like [Glycine max] >... 58 1e-07 ref|XP_004512835.1| PREDICTED: uncharacterized protein LOC101495... 57 2e-07 ref|XP_004309433.1| PREDICTED: uncharacterized protein LOC101294... 56 5e-07 ref|XP_023552410.1| protein SRC2-like [Cucurbita pepo subsp. pepo] 55 1e-06 ref|XP_022984981.1| protein SRC2-like [Cucurbita maxima] 55 1e-06 ref|XP_021592993.1| protein SRC2 homolog [Manihot esculenta] >gi... 55 1e-06 ref|XP_012083239.1| actin cytoskeleton-regulatory complex protei... 55 1e-06 ref|XP_021827001.1| LOW QUALITY PROTEIN: protein SRC2 [Prunus av... 55 1e-06 ref|XP_007218770.1| protein SRC2 [Prunus persica] >gi|1139791950... 55 1e-06 ref|XP_008234191.1| PREDICTED: protein SRC2 isoform X2 [Prunus m... 55 1e-06 ref|XP_022922921.1| protein SRC2 homolog isoform X3 [Cucurbita m... 55 2e-06 ref|XP_022922919.1| protein SRC2 homolog isoform X2 [Cucurbita m... 55 2e-06 ref|XP_021671362.1| protein SRC2 [Hevea brasiliensis] 55 2e-06 ref|XP_022922918.1| WW domain-containing protein C11B10.08-like ... 55 2e-06 gb|OWM79552.1| hypothetical protein CDL15_Pgr022964 [Punica gran... 54 2e-06 ref|XP_024178591.1| uncharacterized protein LOC112184560 [Rosa c... 54 3e-06 gb|PRQ50876.1| putative C2 domain-containing protein [Rosa chine... 54 5e-06 >ref|XP_013452154.1| C2 domain protein [Medicago truncatula] gb|ACJ84898.1| unknown [Medicago truncatula] gb|AFK45218.1| unknown [Medicago truncatula] gb|KEH26182.1| C2 domain protein [Medicago truncatula] Length = 301 Score = 65.5 bits (158), Expect = 3e-10 Identities = 35/59 (59%), Positives = 37/59 (62%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYRXXXXXXXXXXXXXXXXNSSRDYS 177 VGI ER RSLTLKRPSGRP GKVDVKV+IRE GYR SSRDY+ Sbjct: 104 VGIGERASRSLTLKRPSGRPHGKVDVKVIIREPGYRGSGEYYAPPYGVPPPQASSRDYN 162 >gb|PNX88030.1| putative peroxisomal membrane protein PEX13-like [Trifolium pratense] Length = 292 Score = 61.2 bits (147), Expect = 9e-09 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VGI ERT RSL LKRPSGRPQGK+DVKV IRE GYR Sbjct: 104 VGIGERTSRSLKLKRPSGRPQGKLDVKVTIREPGYR 139 >dbj|GAU24599.1| hypothetical protein TSUD_289600 [Trifolium subterraneum] Length = 298 Score = 59.3 bits (142), Expect = 4e-08 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VGI ERT RSL LKRPSGRP GK+DVKV IRE GYR Sbjct: 104 VGIGERTSRSLKLKRPSGRPHGKLDVKVTIREPGYR 139 >ref|XP_003549032.1| PREDICTED: protein SRC2-like [Glycine max] gb|KRH08884.1| hypothetical protein GLYMA_16G180300 [Glycine max] Length = 256 Score = 57.8 bits (138), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG+ E R+L+LKRPSGRPQGKVDV VVIRE GYR Sbjct: 104 VGVGESVNRTLSLKRPSGRPQGKVDVNVVIREFGYR 139 >ref|XP_004512835.1| PREDICTED: uncharacterized protein LOC101495739 [Cicer arietinum] Length = 295 Score = 57.4 bits (137), Expect = 2e-07 Identities = 31/58 (53%), Positives = 34/58 (58%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYRXXXXXXXXXXXXXXXXNSSRDY 174 VGI ER RSLTL+RPSGRP GKVDVKVVI+ YR +SRDY Sbjct: 104 VGIGERVSRSLTLRRPSGRPHGKVDVKVVIKVPDYRGSGSYYAPPYGVPPPPTTSRDY 161 >ref|XP_004309433.1| PREDICTED: uncharacterized protein LOC101294323 [Fragaria vesca subsp. vesca] Length = 277 Score = 56.2 bits (134), Expect = 5e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG +ER+ R+LT+KRPSGRPQGKVDVKV +RE YR Sbjct: 104 VGYDERSSRTLTIKRPSGRPQGKVDVKVTVREPRYR 139 >ref|XP_023552410.1| protein SRC2-like [Cucurbita pepo subsp. pepo] Length = 286 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG+ ERT R+L LKRPSGRPQGKV+VKV +RE YR Sbjct: 104 VGLGERTDRTLQLKRPSGRPQGKVEVKVTVRESRYR 139 >ref|XP_022984981.1| protein SRC2-like [Cucurbita maxima] Length = 286 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG+ ERT R+L LKRPSGRPQGKV+VKV +RE YR Sbjct: 104 VGLGERTERTLQLKRPSGRPQGKVEVKVTVRESRYR 139 >ref|XP_021592993.1| protein SRC2 homolog [Manihot esculenta] gb|OAY30352.1| hypothetical protein MANES_14G023900 [Manihot esculenta] Length = 272 Score = 55.1 bits (131), Expect = 1e-06 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VGI ER RSL LKRPSGRPQGKVDVKV IR YR Sbjct: 104 VGIGERVKRSLQLKRPSGRPQGKVDVKVTIRNPQYR 139 >ref|XP_012083239.1| actin cytoskeleton-regulatory complex protein pan1 [Jatropha curcas] gb|KDP46959.1| hypothetical protein JCGZ_07976 [Jatropha curcas] Length = 274 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG ERT+RSL LKRPSGRPQGK+DV V IR+ YR Sbjct: 104 VGFGERTVRSLQLKRPSGRPQGKLDVAVTIRQPRYR 139 >ref|XP_021827001.1| LOW QUALITY PROTEIN: protein SRC2 [Prunus avium] Length = 285 Score = 55.1 bits (131), Expect = 1e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG +ER R+L LKRPSGRPQGKVDVKV IRE YR Sbjct: 104 VGFDERASRTLQLKRPSGRPQGKVDVKVTIREPRYR 139 >ref|XP_007218770.1| protein SRC2 [Prunus persica] gb|ONI25377.1| hypothetical protein PRUPE_2G298800 [Prunus persica] Length = 288 Score = 55.1 bits (131), Expect = 1e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG +ER R+L LKRPSGRPQGKVDVKV IRE YR Sbjct: 104 VGFDERASRTLQLKRPSGRPQGKVDVKVTIREPRYR 139 >ref|XP_008234191.1| PREDICTED: protein SRC2 isoform X2 [Prunus mume] ref|XP_008234192.1| PREDICTED: protein SRC2 isoform X1 [Prunus mume] ref|XP_008234193.1| PREDICTED: protein SRC2 isoform X3 [Prunus mume] Length = 289 Score = 55.1 bits (131), Expect = 1e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG +ER R+L LKRPSGRPQGKVDVKV IRE YR Sbjct: 104 VGFDERASRTLQLKRPSGRPQGKVDVKVTIREPRYR 139 >ref|XP_022922921.1| protein SRC2 homolog isoform X3 [Cucurbita moschata] Length = 264 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG ERT R+L LKRPSGRPQGKV+VKV +RE YR Sbjct: 104 VGFGERTDRTLQLKRPSGRPQGKVEVKVTVRESRYR 139 >ref|XP_022922919.1| protein SRC2 homolog isoform X2 [Cucurbita moschata] Length = 275 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG ERT R+L LKRPSGRPQGKV+VKV +RE YR Sbjct: 104 VGFGERTDRTLQLKRPSGRPQGKVEVKVTVRESRYR 139 >ref|XP_021671362.1| protein SRC2 [Hevea brasiliensis] Length = 275 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG+ ER R+L LKRPSGRPQGKVDVKV IRE YR Sbjct: 104 VGVGERAKRTLQLKRPSGRPQGKVDVKVSIREPRYR 139 >ref|XP_022922918.1| WW domain-containing protein C11B10.08-like isoform X1 [Cucurbita moschata] Length = 294 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG ERT R+L LKRPSGRPQGKV+VKV +RE YR Sbjct: 104 VGFGERTDRTLQLKRPSGRPQGKVEVKVTVRESRYR 139 >gb|OWM79552.1| hypothetical protein CDL15_Pgr022964 [Punica granatum] gb|PKI50744.1| hypothetical protein CRG98_028886 [Punica granatum] Length = 263 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +1 Query: 4 GINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 GI ER RSL LKRPSGRPQGK+DV V IR+L YR Sbjct: 105 GIGERLTRSLQLKRPSGRPQGKIDVTVCIRDLRYR 139 >ref|XP_024178591.1| uncharacterized protein LOC112184560 [Rosa chinensis] Length = 209 Score = 53.5 bits (127), Expect = 3e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG ER R+L LKRPSGRPQGKVDVKV +RE YR Sbjct: 104 VGYEERASRTLHLKRPSGRPQGKVDVKVTVREPRYR 139 >gb|PRQ50876.1| putative C2 domain-containing protein [Rosa chinensis] Length = 273 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 1 VGINERTIRSLTLKRPSGRPQGKVDVKVVIRELGYR 108 VG ER R+L LKRPSGRPQGKVDVKV +RE YR Sbjct: 104 VGYEERASRTLHLKRPSGRPQGKVDVKVTVREPRYR 139