BLASTX nr result
ID: Astragalus23_contig00004112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00004112 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007159285.1| hypothetical protein PHAVU_002G225100g [Phas... 68 3e-10 ref|XP_020220834.1| sodium/hydrogen exchanger 6-like [Cajanus ca... 65 3e-09 gb|KHN14386.1| Sodium/hydrogen exchanger 6 [Glycine soja] 64 1e-08 ref|XP_006597645.1| PREDICTED: sodium/hydrogen exchanger 6 [Glyc... 64 1e-08 gb|KHN40748.1| Sodium/hydrogen exchanger 6 [Glycine soja] 59 4e-07 ref|XP_006586810.1| PREDICTED: sodium/hydrogen exchanger 6-like ... 59 4e-07 ref|XP_004486408.1| PREDICTED: sodium/hydrogen exchanger 6-like ... 57 2e-06 ref|XP_003594403.2| Na+/H+ exchanger 1 [Medicago truncatula] >gi... 55 7e-06 >ref|XP_007159285.1| hypothetical protein PHAVU_002G225100g [Phaseolus vulgaris] gb|ESW31279.1| hypothetical protein PHAVU_002G225100g [Phaseolus vulgaris] Length = 534 Score = 68.2 bits (165), Expect = 3e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 488 FFTSQNGDEDDEAEPFTSTRSGYHGQSPYSS 396 FFTSQNGDEDDEAEPFTSTRSG+HGQSPYSS Sbjct: 504 FFTSQNGDEDDEAEPFTSTRSGFHGQSPYSS 534 >ref|XP_020220834.1| sodium/hydrogen exchanger 6-like [Cajanus cajan] Length = 536 Score = 65.1 bits (157), Expect = 3e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 488 FFTSQNGDEDDEAEPFTSTRSGYHGQSPYSS 396 FFTSQNGDEDDEAEPFTSTRSG+HG +PYSS Sbjct: 506 FFTSQNGDEDDEAEPFTSTRSGFHGHNPYSS 536 >gb|KHN14386.1| Sodium/hydrogen exchanger 6 [Glycine soja] Length = 520 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 488 FFTSQNGDEDDEAEPFTSTRSGYHGQSPYSS 396 FFTSQNGDEDDEAEPFTSTRSG+HGQ+ YSS Sbjct: 490 FFTSQNGDEDDEAEPFTSTRSGFHGQNHYSS 520 >ref|XP_006597645.1| PREDICTED: sodium/hydrogen exchanger 6 [Glycine max] gb|KRH11690.1| hypothetical protein GLYMA_15G124100 [Glycine max] Length = 534 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 488 FFTSQNGDEDDEAEPFTSTRSGYHGQSPYSS 396 FFTSQNGDEDDEAEPFTSTRSG+HGQ+ YSS Sbjct: 504 FFTSQNGDEDDEAEPFTSTRSGFHGQNHYSS 534 >gb|KHN40748.1| Sodium/hydrogen exchanger 6 [Glycine soja] Length = 459 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 488 FFTSQNGDEDDEAEPFTSTRSGYHGQSPYSS 396 FFTSQNGDEDDEAEPFTSTRS HGQ+ YSS Sbjct: 429 FFTSQNGDEDDEAEPFTSTRSELHGQNHYSS 459 >ref|XP_006586810.1| PREDICTED: sodium/hydrogen exchanger 6-like [Glycine max] gb|KRH36691.1| hypothetical protein GLYMA_09G018200 [Glycine max] Length = 534 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 488 FFTSQNGDEDDEAEPFTSTRSGYHGQSPYSS 396 FFTSQNGDEDDEAEPFTSTRS HGQ+ YSS Sbjct: 504 FFTSQNGDEDDEAEPFTSTRSELHGQNHYSS 534 >ref|XP_004486408.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X3 [Cicer arietinum] Length = 549 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/37 (72%), Positives = 29/37 (78%), Gaps = 6/37 (16%) Frame = -1 Query: 488 FFTSQNGDEDDEAEPFTST------RSGYHGQSPYSS 396 FFTS NGDEDDE EPFTST RSG+HGQSPY+S Sbjct: 509 FFTSHNGDEDDEVEPFTSTRSFTSSRSGFHGQSPYAS 545 >ref|XP_003594403.2| Na+/H+ exchanger 1 [Medicago truncatula] gb|AES64654.2| Na+/H+ exchanger 1 [Medicago truncatula] Length = 530 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 6/37 (16%) Frame = -1 Query: 488 FFTSQNGDEDDEAEP------FTSTRSGYHGQSPYSS 396 FFTS NGDED+EAEP FTS+RSG+HGQSPY+S Sbjct: 493 FFTSHNGDEDEEAEPFTSARSFTSSRSGFHGQSPYAS 529