BLASTX nr result
ID: Astragalus22_contig00015939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00015939 (619 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013467460.1| hypothetical protein MTR_1g051605 [Medicago ... 54 1e-06 ref|XP_003615287.1| hypothetical protein MTR_5g066150 [Medicago ... 54 2e-06 ref|XP_003610684.1| hypothetical protein MTR_5g005910 [Medicago ... 53 4e-06 >ref|XP_013467460.1| hypothetical protein MTR_1g051605 [Medicago truncatula] gb|KEH41497.1| hypothetical protein MTR_1g051605 [Medicago truncatula] Length = 58 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 415 VSRGVRGAVWFGFEQKSAPNREIKIDAIWFGSVGF 519 V RGVRGAVWFGF+ + PNRE K A+WFGSV F Sbjct: 24 VLRGVRGAVWFGFKHNNHPNRERKKHAVWFGSVDF 58 >ref|XP_003615287.1| hypothetical protein MTR_5g066150 [Medicago truncatula] gb|AES98245.1| hypothetical protein MTR_5g066150 [Medicago truncatula] Length = 59 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 421 RGVRGAVWFGFEQKSAPNREIKIDAIWFGSVGF 519 RGVRGAVWFGF+ + PNRE K A+WFGSV F Sbjct: 27 RGVRGAVWFGFKHNNHPNRERKKHAVWFGSVDF 59 >ref|XP_003610684.1| hypothetical protein MTR_5g005910 [Medicago truncatula] gb|AES93642.1| hypothetical protein MTR_5g005910 [Medicago truncatula] Length = 58 Score = 52.8 bits (125), Expect = 4e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 412 VVSRGVRGAVWFGFEQKSAPNREIKIDAIWFGSVGF 519 V++RGVRGAVWFGF+ + PNRE + +WFGSV F Sbjct: 23 VMARGVRGAVWFGFKHNNHPNREREKHTVWFGSVDF 58