BLASTX nr result
ID: Astragalus22_contig00015742
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00015742 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH14888.1| hypothetical protein GLYMA_14G054900 [Glycine max] 53 5e-06 dbj|GAU18160.1| hypothetical protein TSUD_248610 [Trifolium subt... 53 7e-06 >gb|KRH14888.1| hypothetical protein GLYMA_14G054900 [Glycine max] Length = 180 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -2 Query: 364 REYRLLXXXXXXXXXXXXEKFTEVIKDFDSMTPLDSWKTT 245 REYRLL KFTEVIK+FDSMTPLDSWKTT Sbjct: 121 REYRLLADIAAAIDEEDVGKFTEVIKEFDSMTPLDSWKTT 160 >dbj|GAU18160.1| hypothetical protein TSUD_248610 [Trifolium subterraneum] Length = 180 Score = 52.8 bits (125), Expect = 7e-06 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = -2 Query: 364 REYRLLXXXXXXXXXXXXEKFTEVIKDFDSMTPLDSWKTT 245 REYRLL KFTEV+K+FDSMTPLDSWKTT Sbjct: 121 REYRLLADVAAALDEEDVAKFTEVVKEFDSMTPLDSWKTT 160