BLASTX nr result
ID: Astragalus22_contig00009442
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00009442 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009777504.1| PREDICTED: vacuolar protein sorting-associat... 79 4e-16 ref|XP_016509121.1| PREDICTED: vacuolar protein sorting-associat... 79 5e-16 gb|KOM50648.1| hypothetical protein LR48_Vigan08g147500 [Vigna a... 75 9e-16 ref|XP_006349016.1| PREDICTED: vacuolar protein sorting-associat... 79 2e-15 gb|PIN25890.1| Vacuolar sorting protein VPS24 [Handroanthus impe... 79 2e-15 ref|XP_019232368.1| PREDICTED: vacuolar protein sorting-associat... 79 2e-15 ref|XP_016498520.1| PREDICTED: vacuolar protein sorting-associat... 79 2e-15 ref|XP_011088790.1| vacuolar protein sorting-associated protein ... 79 2e-15 ref|XP_009619509.1| PREDICTED: vacuolar protein sorting-associat... 79 2e-15 ref|XP_012827934.1| PREDICTED: vacuolar protein sorting-associat... 79 2e-15 ref|XP_013455932.1| vacuolar sorting-associated-like protein [Me... 79 2e-15 ref|XP_015887979.1| PREDICTED: vacuolar protein sorting-associat... 75 2e-15 ref|XP_015951782.1| vacuolar protein sorting-associated protein ... 79 3e-15 ref|XP_022867121.1| vacuolar protein sorting-associated protein ... 75 3e-15 ref|XP_003527138.1| PREDICTED: vacuolar protein sorting-associat... 77 7e-15 ref|NP_001239962.1| uncharacterized protein LOC100797244 [Glycin... 77 7e-15 ref|XP_020215326.1| vacuolar protein sorting-associated protein ... 77 7e-15 ref|XP_007132323.1| hypothetical protein PHAVU_011G085100g [Phas... 77 7e-15 ref|XP_004506062.1| PREDICTED: vacuolar protein sorting-associat... 77 7e-15 ref|XP_016176704.1| vacuolar protein sorting-associated protein ... 77 1e-14 >ref|XP_009777504.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1 [Nicotiana sylvestris] Length = 139 Score = 78.6 bits (192), Expect = 4e-16 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEA 53 >ref|XP_016509121.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Nicotiana tabacum] Length = 147 Score = 78.6 bits (192), Expect = 5e-16 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEA 53 >gb|KOM50648.1| hypothetical protein LR48_Vigan08g147500 [Vigna angularis] Length = 63 Score = 75.5 bits (184), Expect = 9e-16 Identities = 38/53 (71%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEK+VQKAI+EA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKSVQKAIREA 53 >ref|XP_006349016.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Solanum tuberosum] ref|XP_010313300.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Solanum lycopersicum] ref|XP_015056929.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Solanum pennellii] ref|XP_015056930.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Solanum pennellii] Length = 220 Score = 78.6 bits (192), Expect = 2e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQILRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEA 53 >gb|PIN25890.1| Vacuolar sorting protein VPS24 [Handroanthus impetiginosus] Length = 222 Score = 78.6 bits (192), Expect = 2e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEA 53 >ref|XP_019232368.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Nicotiana attenuata] gb|OIT28091.1| vacuolar protein sorting-associated protein 24 -like 1 [Nicotiana attenuata] Length = 222 Score = 78.6 bits (192), Expect = 2e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEA 53 >ref|XP_016498520.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Nicotiana tabacum] Length = 222 Score = 78.6 bits (192), Expect = 2e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEA 53 >ref|XP_011088790.1| vacuolar protein sorting-associated protein 24 homolog 1 [Sesamum indicum] Length = 222 Score = 78.6 bits (192), Expect = 2e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEA 53 >ref|XP_009619509.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Nicotiana tomentosiformis] Length = 222 Score = 78.6 bits (192), Expect = 2e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEA 53 >ref|XP_012827934.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Erythranthe guttata] gb|EYU18785.1| hypothetical protein MIMGU_mgv1a013298mg [Erythranthe guttata] Length = 224 Score = 78.6 bits (192), Expect = 2e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRNECRNIERQIRDIQREEKNVQKAIKEA 53 >ref|XP_013455932.1| vacuolar sorting-associated-like protein [Medicago truncatula] gb|AFK35786.1| unknown [Medicago truncatula] gb|KEH29963.1| vacuolar sorting-associated-like protein [Medicago truncatula] Length = 227 Score = 78.6 bits (192), Expect = 2e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKEA 53 >ref|XP_015887979.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Ziziphus jujuba] Length = 102 Score = 75.5 bits (184), Expect = 2e-15 Identities = 38/53 (71%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEK+VQKAI+EA Sbjct: 1 MEKVMNILKPKPNPQQQLRDWQRRLRQECRNIERQIRDIQREEKSVQKAIREA 53 >ref|XP_015951782.1| vacuolar protein sorting-associated protein 24 homolog 1 [Arachis duranensis] ref|XP_016187499.1| vacuolar protein sorting-associated protein 24 homolog 1 [Arachis ipaensis] Length = 229 Score = 78.6 bits (192), Expect = 3e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEA 53 >ref|XP_022867121.1| vacuolar protein sorting-associated protein 24 homolog 1-like [Olea europaea var. sylvestris] Length = 77 Score = 74.7 bits (182), Expect = 3e-15 Identities = 37/53 (69%), Positives = 39/53 (73%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMN+LKPKPNP ECRNIERQIRDIQ+EEK VQKAIKEA Sbjct: 1 MEKVMNVLKPKPNPQQLLRDWQRKLRQECRNIERQIRDIQKEEKGVQKAIKEA 53 >ref|XP_003527138.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1 isoform X1 [Glycine max] gb|KHN19850.1| Vacuolar protein sorting-associated protein 24 like 1 [Glycine soja] gb|KRH54818.1| hypothetical protein GLYMA_06G211400 [Glycine max] gb|KRH54819.1| hypothetical protein GLYMA_06G211400 [Glycine max] Length = 227 Score = 77.4 bits (189), Expect = 7e-15 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAI+EA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREA 53 >ref|NP_001239962.1| uncharacterized protein LOC100797244 [Glycine max] gb|ACU21093.1| unknown [Glycine max] gb|KHN37775.1| Vacuolar protein sorting-associated protein 24 like 1 [Glycine soja] gb|KRH63042.1| hypothetical protein GLYMA_04G151500 [Glycine max] Length = 227 Score = 77.4 bits (189), Expect = 7e-15 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAI+EA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREA 53 >ref|XP_020215326.1| vacuolar protein sorting-associated protein 24 homolog 1 [Cajanus cajan] gb|KYP68587.1| Vacuolar protein sorting-associated protein 24 isogeny 1 [Cajanus cajan] Length = 228 Score = 77.4 bits (189), Expect = 7e-15 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAI+EA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREA 53 >ref|XP_007132323.1| hypothetical protein PHAVU_011G085100g [Phaseolus vulgaris] gb|ESW04317.1| hypothetical protein PHAVU_011G085100g [Phaseolus vulgaris] Length = 228 Score = 77.4 bits (189), Expect = 7e-15 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAI+EA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREA 53 >ref|XP_004506062.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1 [Cicer arietinum] ref|XP_004506063.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1 [Cicer arietinum] Length = 229 Score = 77.4 bits (189), Expect = 7e-15 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKVMNILKPKPNP ECRNIERQIRDIQREEKNVQKAI+EA Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIREA 53 >ref|XP_016176704.1| vacuolar protein sorting-associated protein 24 homolog 1 isoform X1 [Arachis ipaensis] Length = 229 Score = 77.0 bits (188), Expect = 1e-14 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = +2 Query: 197 MEKVMNILKPKPNPXXXXXXXXXXXXXECRNIERQIRDIQREEKNVQKAIKEA 355 MEKV+NILKPKPNP ECRNIERQIRDIQREEKNVQKAIKEA Sbjct: 1 MEKVINILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEKNVQKAIKEA 53