BLASTX nr result
ID: Astragalus22_contig00009388
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00009388 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU51472.1| hypothetical protein TSUD_95870 [Trifolium subte... 57 9e-07 gb|PNX62033.1| hypothetical protein L195_g060954, partial [Trifo... 54 9e-07 dbj|GAU22731.1| hypothetical protein TSUD_138560 [Trifolium subt... 57 1e-06 >dbj|GAU51472.1| hypothetical protein TSUD_95870 [Trifolium subterraneum] Length = 1682 Score = 57.4 bits (137), Expect = 9e-07 Identities = 24/51 (47%), Positives = 30/51 (58%) Frame = +1 Query: 265 LNPLVPDCLSWKNQLDGTYSAQSGYSWLLNRILPLSSNCSDWNWIWKAPGP 417 LN VPDC +W + LDG Y++ SGYSWLL + + N W WIW P Sbjct: 1544 LNIGVPDCFTWNDSLDGVYTSSSGYSWLLKK-KQYNPNNKSWKWIWNLRAP 1593 >gb|PNX62033.1| hypothetical protein L195_g060954, partial [Trifolium pratense] Length = 95 Score = 53.9 bits (128), Expect = 9e-07 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +1 Query: 259 AYLNPLVPDCLSWKNQLDGTYSAQSGYSWLLNR--ILPLSSNCSDWNWIWKAPG 414 A LNP V DC +WK L+G YSA+ GY W LNR + + WNW+W+ G Sbjct: 8 ACLNPQVADCFTWKGNLNGIYSARDGYFW-LNRGDFAGIDIDNISWNWLWQGIG 60 >dbj|GAU22731.1| hypothetical protein TSUD_138560 [Trifolium subterraneum] Length = 385 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Frame = +1 Query: 265 LNPLVPDCLSWKNQLDGTYSAQSGYSWLLNRILPLSSNCSD--WNWIWKAPGP 417 LNP V D +WK L+G Y+AQ GY W LNR+ P +S+ D W+W+W P Sbjct: 171 LNPRVADRYTWKGNLNGLYTAQDGYHW-LNRVKPTNSSTKDISWSWLWHIEAP 222