BLASTX nr result
ID: Astragalus22_contig00009223
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00009223 (828 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012572879.1| PREDICTED: splicing factor U2af large subuni... 98 3e-19 dbj|GAU48346.1| hypothetical protein TSUD_267710 [Trifolium subt... 75 2e-11 gb|PNY15014.1| splicing factor U2af large subunit B-like protein... 75 2e-11 gb|KHN47080.1| Splicing factor U2af large subunit B [Glycine soja] 73 1e-10 ref|XP_019465470.1| PREDICTED: splicing factor U2af large subuni... 66 1e-08 >ref|XP_012572879.1| PREDICTED: splicing factor U2af large subunit A-like isoform X5 [Cicer arietinum] Length = 636 Score = 97.8 bits (242), Expect = 3e-19 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +1 Query: 481 AMLGYLPHCADNGCEPTSVAFMSKEESMHRFLVGLVRLQLETISTLVDVQILSPEL 648 AMLGYLPHCADNG EPTSVAFMSKEES+HRFLVGLVRLQLETISTLVD+ +P + Sbjct: 209 AMLGYLPHCADNGREPTSVAFMSKEESVHRFLVGLVRLQLETISTLVDINASNPTI 264 >dbj|GAU48346.1| hypothetical protein TSUD_267710 [Trifolium subterraneum] Length = 585 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 484 MLGYLPHCADNGCEPTSVAFMSKEESMHRFLVGLVR 591 MLGYLPHCADNG EPTSVAFMSKEESMHRFLVGLVR Sbjct: 206 MLGYLPHCADNGREPTSVAFMSKEESMHRFLVGLVR 241 >gb|PNY15014.1| splicing factor U2af large subunit B-like protein [Trifolium pratense] Length = 592 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 484 MLGYLPHCADNGCEPTSVAFMSKEESMHRFLVGLVR 591 MLGYLPHCADNG EPTSVAFMSKEESMHRFLVGLVR Sbjct: 176 MLGYLPHCADNGREPTSVAFMSKEESMHRFLVGLVR 211 >gb|KHN47080.1| Splicing factor U2af large subunit B [Glycine soja] Length = 653 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = +1 Query: 496 LPHCADNGCEPTSVAFMSKEESMHRFLVGLVRLQLETISTLVDVQILSPEL 648 LPHCADNG EPTSVAFMS EESMH FLVGLVRLQLETI+ + +P + Sbjct: 229 LPHCADNGREPTSVAFMSTEESMHLFLVGLVRLQLETITYFGQITGANPTI 279 >ref|XP_019465470.1| PREDICTED: splicing factor U2af large subunit A-like isoform X4 [Lupinus angustifolius] ref|XP_019465471.1| PREDICTED: splicing factor U2af large subunit A-like isoform X4 [Lupinus angustifolius] Length = 450 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/55 (56%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +1 Query: 484 MLGYLPHCADNGCEPTSVAFMSKEESMHRFLVGLVRLQLETISTL-VDVQILSPE 645 M+GYLPHCADNGCEPTSVAFMS E+S+H FL+ + +E +L VD ++ P+ Sbjct: 1 MVGYLPHCADNGCEPTSVAFMSMEDSLHWFLIIHNHMAIEAKESLEVDTYLIVPQ 55