BLASTX nr result
ID: Astragalus22_contig00009220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00009220 (1086 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY52936.1| hypothetical protein CUMW_145790, partial [Citru... 58 7e-07 dbj|GAU22365.1| hypothetical protein TSUD_106940 [Trifolium subt... 60 5e-06 dbj|GAU22366.1| hypothetical protein TSUD_106930 [Trifolium subt... 60 5e-06 gb|PNY10650.1| OTU domain-containing protein [Trifolium pratense] 59 7e-06 >dbj|GAY52936.1| hypothetical protein CUMW_145790, partial [Citrus unshiu] Length = 125 Score = 58.2 bits (139), Expect = 7e-07 Identities = 34/68 (50%), Positives = 42/68 (61%), Gaps = 8/68 (11%) Frame = -3 Query: 793 LKNEGFSVQSSKAGLSLMRIVRGMHKSFCKEL--------KDSFSKGISITAPKARTRDK 638 L+ F + S GL LMRIVRGM + F +EL K+SFS+GI IT PKARTRDK Sbjct: 57 LRRISFRLFFSVGGLGLMRIVRGMQRLFREELNKITLLSWKESFSQGIGITVPKARTRDK 116 Query: 637 *LNTTLLA 614 NT + + Sbjct: 117 PTNTMIFS 124 >dbj|GAU22365.1| hypothetical protein TSUD_106940 [Trifolium subterraneum] Length = 623 Score = 59.7 bits (143), Expect = 5e-06 Identities = 34/61 (55%), Positives = 40/61 (65%), Gaps = 8/61 (13%) Frame = -3 Query: 796 ILKNEGFSVQSSKA-------GLSLMRIVRGMHKSFC-KELKDSFSKGISITAPKARTRD 641 ++KN G S K GL LMRI+RGM +SFC ++LK SF KGI ITAPKAR RD Sbjct: 34 VVKNLGKFDNSKKVLLFKVVEGLGLMRIIRGMQRSFCCEDLKKSFEKGIGITAPKARARD 93 Query: 640 K 638 K Sbjct: 94 K 94 >dbj|GAU22366.1| hypothetical protein TSUD_106930 [Trifolium subterraneum] Length = 625 Score = 59.7 bits (143), Expect = 5e-06 Identities = 34/61 (55%), Positives = 40/61 (65%), Gaps = 8/61 (13%) Frame = -3 Query: 796 ILKNEGFSVQSSKA-------GLSLMRIVRGMHKSFC-KELKDSFSKGISITAPKARTRD 641 ++KN G S K GL LMRI+RGM +SFC ++LK SF KGI ITAPKAR RD Sbjct: 36 VVKNLGKFDNSKKVLLFKVVEGLGLMRIIRGMQRSFCCEDLKKSFEKGIGITAPKARARD 95 Query: 640 K 638 K Sbjct: 96 K 96 >gb|PNY10650.1| OTU domain-containing protein [Trifolium pratense] Length = 603 Score = 59.3 bits (142), Expect = 7e-06 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -3 Query: 754 GLSLMRIVRGMHKSFC-KELKDSFSKGISITAPKARTRDK 638 GL LMRI+RGM +SFC ++LK SF KGI ITAPKAR RDK Sbjct: 36 GLGLMRIIRGMQRSFCCEDLKKSFEKGIGITAPKARARDK 75