BLASTX nr result
ID: Angelica27_contig00041232
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00041232 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017251022.1 PREDICTED: uncharacterized protein LOC108221670 [... 52 3e-06 >XP_017251022.1 PREDICTED: uncharacterized protein LOC108221670 [Daucus carota subsp. sativus] Length = 534 Score = 51.6 bits (122), Expect(2) = 3e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -3 Query: 305 RDQK*KLLHFLPGLHDSNSTVRSQILLMNPLASVTR 198 R+QK KLL FL GLHDSN+T+R QIL+MNPL ++++ Sbjct: 210 REQKRKLLQFLMGLHDSNTTIRGQILMMNPLPTLSQ 245 Score = 26.6 bits (57), Expect(2) = 3e-06 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 198 AYAFVKQDEKSRQG 157 AY++VKQDEK+R G Sbjct: 246 AYSYVKQDEKARHG 259