BLASTX nr result
ID: Angelica27_contig00040499
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040499 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017228765.1 PREDICTED: transcription factor bHLH94-like [Dauc... 69 8e-12 >XP_017228765.1 PREDICTED: transcription factor bHLH94-like [Daucus carota subsp. sativus] KZM80510.1 hypothetical protein DCAR_032206 [Daucus carota subsp. sativus] Length = 307 Score = 68.6 bits (166), Expect = 8e-12 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 8/52 (15%) Frame = +1 Query: 76 MAMEALCSNEVFNLILYNPTPY------TNYFPN--SFPTSPNLLLENPNEF 207 MAMEALCSN+VFNLILY+PTP+ NY PN SFPT PN L ENPN++ Sbjct: 1 MAMEALCSNQVFNLILYDPTPFNNDDVNNNYCPNSSSFPTCPNFLAENPNDY 52