BLASTX nr result
ID: Angelica27_contig00040449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040449 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM97142.1 hypothetical protein DCAR_015496 [Daucus carota subsp... 55 1e-06 XP_017248622.1 PREDICTED: vacuolar protein sorting-associated pr... 55 1e-06 >KZM97142.1 hypothetical protein DCAR_015496 [Daucus carota subsp. sativus] Length = 893 Score = 55.5 bits (132), Expect = 1e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 339 WYYEYDESVTENVEDNDIATLGSLQMRCILCTATS 235 WYYEY++S +NV+DN+I TLGS QMRCILCT + Sbjct: 855 WYYEYEKSDPDNVDDNNINTLGSPQMRCILCTTAT 889 >XP_017248622.1 PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Daucus carota subsp. sativus] Length = 954 Score = 55.5 bits (132), Expect = 1e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 339 WYYEYDESVTENVEDNDIATLGSLQMRCILCTATS 235 WYYEY++S +NV+DN+I TLGS QMRCILCT + Sbjct: 916 WYYEYEKSDPDNVDDNNINTLGSPQMRCILCTTAT 950