BLASTX nr result
ID: Angelica27_contig00040331
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040331 (212 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017254276.1 PREDICTED: oxygen-independent coproporphyrinogen-... 52 6e-06 >XP_017254276.1 PREDICTED: oxygen-independent coproporphyrinogen-III oxidase-like protein sll1917 [Daucus carota subsp. sativus] Length = 490 Score = 51.6 bits (122), Expect = 6e-06 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 43 MLRSXXXXXXXXXXXXXXXXXLSRNVCNAITQTSPPPVRQNASMNTTT-KTTQPPAS 210 MLRS LS + CNAI QT PPPVRQNAS TTT KT PPAS Sbjct: 1 MLRSTFTPIFTTFPAKPIFPKLSLSTCNAIAQTPPPPVRQNASTKTTTSKTPHPPAS 57