BLASTX nr result
ID: Angelica27_contig00040295
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040295 (256 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN04184.1 hypothetical protein DCAR_005021 [Daucus carota subsp... 61 4e-09 XP_017256484.1 PREDICTED: probable nucleoredoxin 1 [Daucus carot... 59 4e-08 KZM90523.1 hypothetical protein DCAR_022112 [Daucus carota subsp... 59 4e-08 >KZN04184.1 hypothetical protein DCAR_005021 [Daucus carota subsp. sativus] Length = 671 Score = 61.2 bits (147), Expect = 4e-09 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 3 GGLEKEFLDQINVALGWYYWKFQSQKKQIYRSR 101 GGLEKEF DQ+N A GWYYW+F SQKKQIY+ R Sbjct: 625 GGLEKEFFDQLNHAFGWYYWEFSSQKKQIYKRR 657 >XP_017256484.1 PREDICTED: probable nucleoredoxin 1 [Daucus carota subsp. sativus] Length = 664 Score = 58.5 bits (140), Expect = 4e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 3 GGLEKEFLDQINVALGWYYWKFQSQKKQIYRSR 101 GGLEKEFL+Q+N A GWYYW++ SQK+QIY+ R Sbjct: 623 GGLEKEFLEQLNHAFGWYYWEYASQKRQIYKRR 655 >KZM90523.1 hypothetical protein DCAR_022112 [Daucus carota subsp. sativus] Length = 854 Score = 58.5 bits (140), Expect = 4e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 3 GGLEKEFLDQINVALGWYYWKFQSQKKQIYRSR 101 GGLEKEFL+Q+N A GWYYW++ SQK+QIY+ R Sbjct: 813 GGLEKEFLEQLNHAFGWYYWEYASQKRQIYKRR 845