BLASTX nr result
ID: Angelica27_contig00040133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040133 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN05753.1 hypothetical protein DCAR_006590 [Daucus carota subsp... 51 1e-07 >KZN05753.1 hypothetical protein DCAR_006590 [Daucus carota subsp. sativus] Length = 228 Score = 50.8 bits (120), Expect(2) = 1e-07 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +2 Query: 77 EGHLSYDDHNHKQQF*EMRKMYGSSCLYDRQKREPEPGE 193 EGHLS DHNH+++F EMR+M+GSS DRQKRE + E Sbjct: 175 EGHLSSYDHNHRKRFKEMREMHGSSSRDDRQKREQQRQE 213 Score = 32.3 bits (72), Expect(2) = 1e-07 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 168 KSVNQSQEREMAKFA*MYTC 227 K Q QEREMAKFA MYTC Sbjct: 206 KREQQRQEREMAKFAQMYTC 225